KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3773Help
Entry
XBJ1_3773         CDS       T01186                                 

Definition
(GenBank) Putative asparagine synthetase B [glutamine-hydrolyzing] (fragment)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00250  Alanine, aspartate and glutamate metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XBJ1_3773
Enzymes [BR:xbo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     XBJ1_3773
Peptidases [BR:xbo01002]
 Cysteine Peptidases
  Family C44
   XBJ1_3773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 DUF3700 Asn_synthase DUF1933
Motif
Other DBs
NCBI-ProteinID: CBJ82891
UniProt: D3V2B7
Position
complement(3659812..3660552)
Genome map
AA seq 246 aa AA seqDB search
MCGIAAIFTTKKILIEQLDNKLFSMIERIKHRGDLSRFNEHLVKEYVGLATNRLAIVERE
TATQPVSDEERDIHVILNGQIFNYKKIREKLIKRGHEFKGYGDAEVILKAYIEYDLEFVN
MLDGMFAFVIYDNRKSKFLIGRDHVGIKPLYYAKKNDVWYVASEMKSFLALDVEVKTLEP
GSLYDGNELYKYTRYDKSIEKSKDCYLVAKQKVRKLMEEAVESQVDTDLPVAVMFSGGID
GHVLNG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgcagcaatttttacgacaaaaaaaattttaattgaacaattggataat
aagcttttctctatgatagaaaggattaaacatcgaggagatttatctcgttttaatgaa
cacctagttaaagaatacgttgggcttgccacaaatcgcttggcaattgtcgagagagaa
accgcgactcaacctgtttcagacgaagaaagggatattcatgtcatccttaatgggcaa
atattcaattataaaaaaatacgtgaaaaacttatcaaaagaggacacgaatttaaagga
tatggagatgcagaggtaatattaaaggcatatattgaatatgatttagaatttgtaaat
atgctagatggaatgtttgcatttgtcatatatgataatagaaaatcaaagtttctgatc
ggtagagatcacgtgggtataaagcctctttactatgcaaaaaagaatgatgtttggtat
gtggcatcagaaatgaaatcttttctagcacttgatgttgaagttaagacacttgagcct
gggagtctttatgatggtaatgagctttataagtatactcgttatgataaatctatagaa
aaaagcaaggattgttatcttgtagcaaaacaaaaagttcgtaagttgatggaagaggcg
gttgagtctcaagttgacactgatctgccggttgctgttatgtttagtggtggaatagac
ggtcatgtattaaatggttag

DBGET integrated database retrieval system