KEGG   Xenorhabdus bovienii SS-2004: XBJ1_4008Help
Entry
XBJ1_4008         CDS       T01186                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00630  Glyoxylate and dicarboxylate metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01200  Carbon metabolism
Module
xbo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XBJ1_4008 (aceA)
Enzymes [BR:xbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XBJ1_4008 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CBJ83126
UniProt: D3V647
Position
complement(3855558..3856865)
Genome map
AA seq 435 aa AA seqDB search
MNNSRTQQIAQLEQEWKHSRWEGITRPYSAEDVVKLRGSVNPEHTLAQMGAKKLWELLHG
KSKKGYVNALGALTGGQALQQAKAGIEAVYLSGWQVAADANTASSMYPDQSLYPVDSVPN
VIKRINNSFRRADQIQWANGIDPDSQEYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVSGVSTLLVARTDADAAD
LLTSDCDPYDSEFITGKRTAEGFFCTRAGIDQAISRGLAYAPYADVVWCETSTPDLEAAR
RFAEAIHAEYPGKLLAYNCSPSFNWKKNLDDKTIASFQEQLSAMGYKFQFITLAGIHSMW
FNMFDLAYDYARGEGMKHYVEKVQGPEFAALERGYTFSSHQQEVGTGYFDKVTTIIQGGT
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattcccgaacacaacagatcgctcaattggaacaagaatggaaacactcacgt
tgggaaggtattactcgcccatacagtgctgaagacgtggttaaattgcgtggttccgtt
aatccagaacacactttagcgcagatgggagcgaaaaagttgtgggaactgttacatgga
aaatcaaagaaaggttatgtgaacgcacttggcgccctgactggcggtcaggcacttcag
caagcgaaggcgggcattgaagcagtttatctttctggttggcaggttgctgcggatgca
aatactgcctccagcatgtaccccgatcaatcactttatccagtggattctgtacctaat
gtcattaaacgcatcaataacagtttccgccgtgcagatcagatccaatgggcaaatggt
atcgacccggacagtcaggaatacaccgactatttcctgccgattgtcgcggatgctgaa
gcagggtttggtggtgtgctgaatgcatttgaactgatgaaagcgatgattgaggctggt
gcagcggctgttcattttgaagatcaattggcggcggtgaaaaaatgtggtcacatgggg
ggtaaggtactcgtaccgactcaagaagcgattcagaaactggtggctgctcgtctggct
gctgatgtatccggagtttcaaccttgttagtcgcacgcactgatgccgacgcagcagac
ttgctgacttctgattgtgatccttatgacagcgaattcattactggcaagcgaactgct
gaaggtttcttctgtacccgagctggtatcgatcaggctatcagccgtgggttggcttat
gccccatatgccgacgttgtttggtgcgaaacttctacgccggatcttgaggctgctcgc
cgttttgcggaagccattcatgcggaatacccaggcaaattgctggcatacaactgctct
ccatccttcaactggaaaaagaatctggacgacaaaaccattgcgagctttcaagagcag
ctgtctgccatgggatataaattccaatttattacattggctggtatccacagcatgtgg
tttaacatgtttgatttggcttatgactacgcccgtggtgaaggtatgaaacattatgtc
gaaaaagttcagggacctgaattcgcagctcttgagcgtggttatactttctcttcacat
caacaggaagttgggacagggtattttgataaagtgacaacgattattcagggaggaacg
tcttctgttaccgcacttacgggctcgacagaagaacagcaattttag

DBGET integrated database retrieval system