KEGG   Xenorhabdus bovienii: XBJ1_4009Help
Entry
XBJ1_4009         CDS       T01186                                 

Gene name
aceB
Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xbo  Xenorhabdus bovienii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XBJ1_4009 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XBJ1_4009 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    XBJ1_4009 (aceB)
Enzymes [BR:xbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XBJ1_4009 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3856914..3858512)
Genome map
AA seq 532 aa AA seqDB search
MTQQALTTDLTFTKLFGEAENQILLPESIGFIEDLVVEFSDRRKKLLEERIHWQKKIDDG
ILPDFISETISIRESDWKVQGIPDDLKDRRVEITGPVERKMVINALNSNVKVFMADFEDS
LSPSWDKVISGQINLRDAVNGTISYTSEQGKRYELKSEPAVLVARVRGLHLSEKHVLYKK
EPISGGLFDFALYFYLNHKNLLANGSGPYFYLPKIQSYHEAQWWSDVFSFTEERFNLPKG
TIKATVLIETLSAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHSDRVLPDRQSV
TMTQPFLSAYSRLLIKTCHKRGAFAMGGMSAFIPSKDIEQNQWIMDKVRADKELEAKNGH
DGTWIAHPGLADIAMTVFNTTLGERPNQLAVSREEDETITAEQLLEPCLGERTEEGLRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHEKLLSNGKKVTKELFRQ
MLKEELGIIKQEVGEMNFNQGRFMEASNLMERITTQDELIDFLTLPGYQLLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcaagcattaacaactgatttaacctttacaaagctttttggtgaagctgaa
aatcagatattactacctgaatctataggttttatagaagatctagttgttgagttttct
gacaggcgtaaaaaattattggaagagagaattcactggcagaaaaaaatagatgatgga
atattacctgattttatttcggaaacaatttccattagggaaagtgactggaaagttcag
ggaattcctgacgatcttaaagatcgccgtgttgaaatcacgggtccagtagaacgtaag
atggtgattaacgctttgaattcaaatgttaaagttttcatggcggattttgaagattca
ctgtctccttcatgggataaagtcattagtgggcaaattaatctaagggacgcagttaac
ggtacgatctcatataccagtgagcaaggtaagcgttatgaattgaaatctgaaccggca
gttctggttgcacgggtcagagggctgcatctgtcagaaaaacacgttctttacaagaag
gaaccgatctcgggtggtctatttgactttgcactttacttctatctaaatcataaaaat
ctgctggcaaatggcagcggcccctatttttatttgcctaaaattcagagctaccacgaa
gctcaatggtggagcgatgttttcagttttacggaagagcgcttcaacctaccaaaaggt
acaatcaaagcgaccgttctgattgaaacactgtctgctgtattccagatggatgaaatc
ctctaccacctgcgtcaccacattgttgggctgaactgtgggcgctgggattacattttc
agttatatcaagacactgaaaaaccattctgatcgtgttttgcctgatcgccagtcggtc
acgatgacacaacctttcctgagtgcctattctcgcttgctgattaaaacttgccataaa
cgtggtgcatttgcgatggggggaatgtcggcattcataccaagcaaagatattgaacaa
aaccagtggattatggacaaggtcagggctgacaaagaactggaagctaagaacggtcac
gatggcacatggatagcgcatcctgggcttgcagatattgcgatgacagtcttcaacacc
accttaggagagcggccgaaccaattggcagtttcccgtgaagaagacgaaacgatcaca
gcggaacaattgcttgaaccttgcttgggagagagaacggaagaaggattgagagcgaat
attcgtgtcgctgtgcagtatatagaagcatggatttcaggtaatgggtgtgtaccgatt
tatggtttgatggaagatgccgctactgcggaaatatctcgcacatctatttggcaatgg
atccgccatgaaaaattactttccaacggtaaaaaagtcacaaaagagctgttcaggcaa
atgctgaaagaagaactgggcattattaaacaagaagttggagagatgaatttcaaccaa
gggcgatttatggaggcttctaatctaatggaacggattactacacaggatgagctaatc
gatttcctgactttgccgggttatcaattactcgattaa

DBGET integrated database retrieval system