KEGG   Xenorhabdus bovienii: XBJ1_4043Help
Entry
XBJ1_4043         CDS       T01186                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xbo  Xenorhabdus bovienii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XBJ1_4043 (malQ)
Enzymes [BR:xbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     XBJ1_4043 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3891138..3893246
Genome map
AA seq 702 aa AA seqDB search
MENKHLDNLATEAGIAAEYINAYGKPQAIPAEIRHRILAAMYTDPPANRPVSDASILTLP
VVKVMTQGQTITLPLSSTENYRWQIQTEQGETFQGDCQYQITLPTNLPLGYHTLTLMPVK
SISVTEPHSQHPVMQIIVTPERCYEPETLINGEKLWGACIQLYTLRSENNWGIGDFGDLK
YMLQELTQRGGAFIGLNPLHAMYPAMPEDASPYSPSSRHWLNIIYIDVNQVEDFTYSVEA
QKWWRLPETQLKLQHVRQTGLVDYTSVMTLKITALRLAYQQFQTRSATDPLHIAFQQFVT
KGGKSLYSQAAYDALHRKLYDEDSAYWGWPVWPEKYREPDSDTVKEFCQSHWPEVEFFLW
LQWLADTQLAGCFTESQHNHMPIGIYRDLAVGVAQGGSETWCNRTVYCTKASIGAPPDIL
GPLGQNWGLPPINPHVLRVQAYQPFIELLRSNMRHCGALRIDHVMSLLRLWWIPQGETAD
KGVYVHYPVDDLLAILALESQRHHCMVIGEDLGIVPEEIVGKLHTRGVYSYKVFYFERDG
HGEFRSPDEYPTQAMATITTHDLPTLRGFWQNKDLILGESIGLYPDKTLLDGLYDERKRC
KQKLLDGLNRHGYSSASLSMTDTPAPMSASINQNIHHYIAHSTSALLGLQPEDWLDMELP
VNIPGTSTEYPNWRRKLSITLEAMFQDEHINQLLQTVGEYRR
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacacctcgacaatttggcaacagaggctggcatagccgccgaatatatt
aatgcctacgggaaaccgcaggctatccctgccgaaattcggcatcggatattggcagcc
atgtatacagacccaccggccaataggccggtttctgatgcatctattcttaccctgcct
gtggttaaagtgatgactcaaggtcagacaatcactttacctttgagcagtacagaaaat
tatcgatggcaaatacagacagagcaaggagagacatttcaaggggactgccaatatcaa
atcactctgccgaccaacctccctctgggctatcacacactgacattaatgccagtaaaa
tcaatatcagtaacagaacctcatagccaacacccggttatgcagattattgtgacgcca
gaacgttgctacgagccagagacactgataaatggcgaaaaactctggggagcctgtatc
cagctctataccttgcgttcagaaaataactggggaatcggcgattttggcgatttgaaa
tatatgctgcaagaactgacgcaacggggtggcgcatttatcggcctgaatccacttcat
gccatgtatccagccatgcctgaagacgccagtccctacagcccttcttcccgtcactgg
ctcaatatcatttatattgatgtgaaccaagtagaagatttcacatacagtgtcgaagct
caaaaatggtggcgattgccggaaactcaactcaagctccagcatgtccgccaaacagga
ttagtcgattacaccagcgtgatgacattaaaaataacagcgctgcgtctggcttatcaa
cagtttcaaacccgatccgctacagatcccctgcatattgcttttcaacaatttgttacc
aaaggtggtaaaagcctttattctcaagcagcctatgatgctctgcaccgtaaactctac
gacgaagacagcgcttactggggctggccggtatggccagaaaaatatcgtgaacctgat
agcgatacggtgaaagaattctgccagtcacattggccggaagtggagtttttcctctgg
ttacaatggctggccgatacccaattagctggctgctttaccgaaagccagcacaatcat
atgcccatcggcatttatcgtgacttggctgttggtgttgcacaaggcggctcagaaaca
tggtgcaaccgaacggtgtattgcaccaaggcatctattggcgcaccaccggacatactc
ggcccactcggacaaaactggggcttacctccgataaacccccatgtattacgagtccaa
gcctatcagccttttattgaattactgcgtagcaatatgcgccactgcggggcattacgt
attgatcacgttatgtcactactcagactatggtggataccacaaggagaaactgccgat
aaaggggtttatgtccattatccagttgacgatttgctggcgatactggcgctggaaagc
caacgccatcactgtatggtgattggcgaagatttagggatcgtgccagaagaaattgtc
ggcaaattacatacccgaggtgtctattcctataaggtgttctattttgaacgggatggg
cacggagaattccgctcacccgatgagtaccccacgcaggcaatggcaaccattactacc
catgatttacctacattacgcggattctggcaaaacaaggatttgatattgggggaatcg
atcggcttatacccagataaaactctacttgatgggttatatgatgaacgtaagcgttgt
aagcagaagttattggacggtctgaaccgccatggttattcatctgcatcactgagtatg
acagacacgccagctccgatgtcagcctctatcaatcaaaacatacatcactacattgcc
cacagcaccagtgccttattgggattgcagcccgaagactggctagatatggaactcccc
gtcaatattccgggaacgtccacagagtatcccaactggcggcgcaaactaagcattacg
ctggaagctatgttccaagatgaacatatcaaccaattacttcaaacggtaggagagtac
cgaaggtaa

DBGET integrated database retrieval system