KEGG   Xenorhabdus bovienii: XBJ1_4143Help
Entry
XBJ1_4143         CDS       T01186                                 

Gene name
pldB
Definition
lysophospholipase L(2) (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
xbo  Xenorhabdus bovienii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    XBJ1_4143 (pldB)
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     XBJ1_4143 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3978499..3979509)
Genome map
AA seq 336 aa AA seqDB search
MAPEILKASWLNREPQFSAFTNGLLLDFWKTRDEREFMGVDDIPIRYVSFRSLHHDKTLL
ILPGRSESYVKYPEIAYDFYHLGYDIFIIDHRGQGRSGRMLDDPQKGHVEKFDHYVDDLA
KFVELEITPRQSHGYYALAHSMGAAILSRFLLRQELVRQEPDFRAVALCAPMFGINLPMP
RWLANFLVNQAEPYPKRRNSYAVSTGQWRPLPYLINLLTHSYARYQRYLRYYADYPELRL
GGPTYHWMRESMQMGDELIENAGVIQTPLIVLKASEDKIVNNRELLAFCESRQKAGTGKA
GRKPLVIQGAHHEILFEKDALRAQALNAICDFFDQH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctgagatattgaaagcaagctggttaaaccgcgaacctcagttctctgcgttt
acgaatggactattactggatttctggaaaaccagagacgaacgggaatttatgggtgtt
gatgatatccctattcgttatgtctctttccgttctctccatcacgataaaacgttgttg
atcctgccgggccgcagtgaaagctatgtgaaatatcctgaaatagcctacgatttttac
cacttgggctacgacatttttattattgatcaccgtgggcaggggcgttcagggcgaatg
cttgatgatccccaaaaaggccacgttgaaaaatttgatcactatgtggatgatctagcc
aaatttgttgaattggaaattaccccgcgtcagtctcacggttattatgcgttggctcat
tcaatgggagccgcgatcctcagccgttttctattacggcaagaacttgtacgtcaagag
cctgattttcgggcggtagctctgtgtgcaccgatgtttggcatcaacttaccgatgccg
cgctggttggcaaattttctggtcaatcaggctgaaccttatcctaaaaggcgtaacagc
tacgcggtatcaacagggcagtggcgtccgttgccctatcttatcaacctgttaacccac
agttatgcacgttatcagcgctatttacgctattatgccgattatcctgaattgcgcctc
ggagggccgacttaccactggatgcgtgaaagtatgcaaatgggagacgaactgattgaa
aatgcaggggtaattcagactccgcttattgttttaaaagcgagtgaagataagatcgtt
aataatcgggagttactggcattttgtgaatctcgacaaaaagccggaacaggaaaagca
ggaagaaaacctctggtcatccaaggggcacatcacgaaatcctgttcgaaaaagatgca
ttgcgggcgcaggctcttaatgcaatttgtgatttttttgaccagcactga

DBGET integrated database retrieval system