KEGG   Xenorhabdus bovienii: XBJ1_4291Help
Entry
XBJ1_4291         CDS       T01186                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xbo  Xenorhabdus bovienii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xbo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4113937..4115460
Genome map
AA seq 507 aa AA seqDB search
MTIENITEKKYIVALDQGTTSSRAVVLDHDANIVCISQREFPQIYPKPGWVEHDPMEIWA
SQSSTLVEVLAKSDISSDQIASIGITNQRETTIVWEKETGRPVYNAIVWQCRRTADICTK
LKQKEGLEEYIRHNTGLVVDPYFSGTKIKWILDNVEGIRHRAENGELLFGTVDTWLVWKM
TQGRVHVTDYTNASRTMLFNIHNLDWDQKILDELDIPRIMLPKVSSSSEIYGQTNIGGKG
GTRIPIAGIAGDQQAALYGQLCVHPGMAKNTYGTGCFLLMNTGTDAVRSSHGLLTTIACG
PRGEVNYALEGAVFVGGASIQWLRDELKLIADAADSEYFATKVKDSNGVYVVPAFTGLGA
PYWDPYARGAIFGLTRGANSNHIIRATLESIAYQTRDVLDAMQADSGTRLKSLRVDGGAV
ANNFLMQFQADILGTRVERPDVRESTALGAAFLAGLAVGFWKDLDEVKSKATIEKEFRPG
IETTERNHKYNGWKKAVARAQEWEDRA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagaaaatatcactgaaaaaaaatatatcgtcgccctcgatcaagggacaacc
agttcacgagctgtcgtactcgatcacgatgccaatattgtctgtatttcacagcgtgaa
ttcccgcaaatctaccccaaaccaggctgggtagagcacgacccaatggaaatctgggcc
agccaaagctcaacattggtcgaagtgctggcaaaatctgatatcagttcagatcaaatt
gccagcatagggatcactaaccagcgagaaacaacgattgtctgggaaaaagaaacaggt
aggccagtttataacgcgattgtatggcaatgtcgccgaacagcagatatttgtaccaaa
ttaaaacaaaaagaaggattagaagaatatatccgccacaatactggcttggttgtcgat
ccttacttctccggaacaaaaataaaatggattctggataatgtagaaggcatccgccat
cgtgctgaaaatggcgaactgttattcggtacagtcgatacctggctcgtctggaaaatg
actcagggtcgtgtgcatgtgaccgattacaccaatgcttcccgcaccatgctattcaat
atccacaatctcgattgggatcagaaaatccttgatgagctggatattccccgcattatg
ctgccaaaagtgtcatcttcgtcagagatttatggtcagaccaatattggtggtaaaggt
ggcacacgcattcctatcgcgggtattgcaggcgaccagcaggcagccctgtacggccaa
ttgtgtgttcatcccggcatggcaaaaaatacttacgggacaggctgcttcctgctgatg
aatacaggaacagatgcagtacgttccagtcacggcctgctgaccactattgcctgcggg
ccacggggtgaagtgaactatgcactggaaggcgctgtcttcgttggcggcgcgtctatc
caatggctacgtgatgaattgaaactcatcgccgatgcggcggattccgaatatttcgcc
actaaagtgaaggacagcaatggtgtgtacgttgtaccagcctttactggcctaggcgca
ccttactgggacccttacgcccgtggcgctattttcggcctgactcgtggtgcgaacagc
aaccatattattcgcgccacgctagaatctatcgcttaccagacccgtgatgtattggat
gcaatgcaggctgactccggcacacgcctgaaatccctgcgtgtagatggtggggctgtc
gctaacaatttcctgatgcaattccaggccgatattctgggtactcgtgtagaacgccct
gacgtacgtgaaagtacagcgttgggtgccgccttcctcgctggcctggccgtcggtttc
tggaaagaccttgatgaagtgaagagcaaagcgacaatcgaaaaagagttccgtccgggc
atcgaaaccactgagcgaaaccataaatataatggctggaaaaaagcggttgcccgcgct
caggaatgggaagaccgcgcttaa

DBGET integrated database retrieval system