KEGG   Xenorhabdus bovienii: XBJ1_4297Help
Entry
XBJ1_4297         CDS       T01186                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xbo  Xenorhabdus bovienii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XBJ1_4297 (tpiA)
   01230 Biosynthesis of amino acids
    XBJ1_4297 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XBJ1_4297 (tpiA)
   00051 Fructose and mannose metabolism
    XBJ1_4297 (tpiA)
   00562 Inositol phosphate metabolism
    XBJ1_4297 (tpiA)
Enzymes [BR:xbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XBJ1_4297 (tpiA)
Exosome [BR:xbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XBJ1_4297 (tpiA)
  Exosomal proteins of bladder cancer cells
   XBJ1_4297 (tpiA)
  Exosomal proteins of melanoma cells
   XBJ1_4297 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4119153..4119920
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNDLIAGLRKELSNVDGCGVAIAPPTVYVSLAKNALAGSRIA
LGAQDVDVNLSGAFTGETSAEMLKDVGAKYIIIGHSERRTYHKESDELIAKKFTILKEQG
LIPVLCIGETEQENEAGQTEAVCARQIDAVLNTLGAEAFKDTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAIAGQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggaaactggaaattaaatggcagtacccacatggttaac
gacctgattgcaggcctgcgtaaagaactgagcaatgttgacggctgtggcgtcgctatc
gcaccaccaacagtttatgtttctctggcaaaaaatgcactggctggcagccgtatcgct
ctgggtgcacaagatgttgacgttaacctttctggtgcattcaccggcgaaacatccgct
gaaatgctgaaagatgtgggcgcgaaatatatcattatcggtcattctgagcgccggact
taccataaagaaagcgatgagctgattgcgaaaaaattcaccatcctgaaagaacaagga
ctgattcccgttctgtgcattggtgaaaccgaacaggaaaatgaagcaggccaaaccgaa
gccgtatgcgcacgccaaatcgatgctgttctgaatacactgggtgccgaagccttcaaa
gataccgttatcgcatacgagcccgtctgggcaattggtacgggtaaatcagcgactcct
gcacaagcacaggctgttcataaatttatccgtgatcatatcgcgaagcaagatgcagct
atcgctggacaggtcatcattcaatacggcggttccgtcaatgccggcaacgcggcagaa
ctgttcacccagccagatatcgatggtgctctggttggtggtgcatccctgaaagccgat
gctttcgccgttattgtgaaagccgctgccgaagcgaaaaaggcataa

DBGET integrated database retrieval system