KEGG   Xenorhabdus bovienii: XBJ1_4349Help
Entry
XBJ1_4349         CDS       T01186                                 

Gene name
waaA
Definition
3-deoxy-D-manno-octulosonic-acid transferase (EC:2.-.-.-)
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
xbo  Xenorhabdus bovienii
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:xbo00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4167432..4168796
Genome map
AA seq 454 aa AA seqDB search
MSIKGAAFYTLSSGQCGTIAAVYVSEFDRMLLRLYQVLLYLIQPLIWLRLLLRSRKSPAY
RKRWGERYGFCAKKVAKGGILLHSVSVGETLAAIPLVRILRHHYPFLPITVTTMTPTGSE
RVLSALGTDVNHVYLPYDLPGSMSRFLDNVNPKLVIIMETELWPNLITQLNQREIPLVIA
NARLSTRSAAGYQKISNFIKTILNKITLIAAQNQEDGERFIELGLKRSQLAVTGSLKFDI
SVTPELAAKAVTLRRQWAPHRPVWIATSTHDGEETIILDAHCKLIQQFPDLLLILVPRHP
ERFTKAAELTQKAGLNSILRSSDTIPDPNVQVVIGDTMGELMLLYGIADLAFVGGSLVER
GGHNPLEAAAHAIPVIMGPHTFNFKDICAKLDKANGLIAVTDSHSLSAAINSLLTDEDYR
LYYGRHAAEVLHENQGALQRLLKLLEPYLPPRGH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ttgtccataaaaggggccgcattttacacactttcttcaggccaatgtggtactatagcc
gcagtctatgtcagtgaatttgatagaatgttgcttcgcttatatcaggtacttctctac
cttatccaaccgcttatctggttacgcctgctgttgcgcagccgtaaatcccctgcgtac
cgtaaacgctggggtgaacgttatggtttttgtgccaaaaaagtcgcaaaaggtggaata
ttactccattccgtttctgttggagaaacattggctgccattccattagtaagaatacta
cggcaccattatcctttcctgccgattaccgtgacaacaatgacaccaactggctctgaa
agggtgctttctgctttaggtactgatgtcaaccacgtttacctcccctatgatttgcct
ggctccatgagccgtttccttgataacgtcaaccccaagctggtgattattatggaaaca
gaattatggcccaatttgattacccaactgaaccaacgcgaaatccctctggtcattgcc
aatgcaaggttatcaacccgttcagcagcgggatatcaaaaaatcagcaactttattaaa
accattttaaataaaataacactgattgccgcacaaaatcaggaagatggtgagcgcttc
atcgaactcggcttaaaacgttcccaactcgccgtcactggcagcctgaaattcgacatt
tctgtcacgccagaactggcagcaaaagcggttacactgcgccgccaatgggcgccacat
cgtcctgtctggattgccaccagcacccatgatggagaagaaaccatcatattggatgcg
cactgcaaattaattcaacaatttcctgatctactgttaattctagtaccacgccatcct
gaacgttttaccaaggccgcagagttaacccaaaaagcgggattaaattcgatattaagg
agctctgacacaatacctgatcccaatgtgcaggtggttatcggagatactatgggcgaa
ttgatgctcttgtatggtatcgctgatctggcttttgtcggagggagtctggtcgagcgt
ggcggtcataatccactggaagccgcagctcatgccatccctgtcattatggggccacat
actttcaactttaaagatatttgtgccaagctggataaagccaatggccttatcgccgtt
acggatagtcactcgttgagtgccgctatcaatagcctgctgacagatgaggactatcgt
ctttattacggtcgccatgccgccgaagtcctgcacgaaaatcagggagcacttcagcga
ttgctaaaattactggaaccttatctcccgccacggggtcattga

DBGET integrated database retrieval system