KEGG   Xenorhabdus bovienii: XBJ1_4349Help
Entry
XBJ1_4349         CDS       T01186                                 

Gene name
waaA
Definition
3-deoxy-D-manno-octulosonic-acid transferase (EC:2.-.-.-)
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
xbo  Xenorhabdus bovienii
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    XBJ1_4349 (waaA)
Enzymes [BR:xbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     XBJ1_4349 (waaA)
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     XBJ1_4349 (waaA)
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     XBJ1_4349 (waaA)
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     XBJ1_4349 (waaA)
Glycosyltransferases [BR:xbo01003]
 Polysaccharide
  Bacterial polysaccharide
   XBJ1_4349 (waaA)
Lipopolysaccharide biosynthesis proteins [BR:xbo01005]
 Core region
  XBJ1_4349 (waaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4167432..4168796
Genome map
AA seq 454 aa AA seqDB search
MSIKGAAFYTLSSGQCGTIAAVYVSEFDRMLLRLYQVLLYLIQPLIWLRLLLRSRKSPAY
RKRWGERYGFCAKKVAKGGILLHSVSVGETLAAIPLVRILRHHYPFLPITVTTMTPTGSE
RVLSALGTDVNHVYLPYDLPGSMSRFLDNVNPKLVIIMETELWPNLITQLNQREIPLVIA
NARLSTRSAAGYQKISNFIKTILNKITLIAAQNQEDGERFIELGLKRSQLAVTGSLKFDI
SVTPELAAKAVTLRRQWAPHRPVWIATSTHDGEETIILDAHCKLIQQFPDLLLILVPRHP
ERFTKAAELTQKAGLNSILRSSDTIPDPNVQVVIGDTMGELMLLYGIADLAFVGGSLVER
GGHNPLEAAAHAIPVIMGPHTFNFKDICAKLDKANGLIAVTDSHSLSAAINSLLTDEDYR
LYYGRHAAEVLHENQGALQRLLKLLEPYLPPRGH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ttgtccataaaaggggccgcattttacacactttcttcaggccaatgtggtactatagcc
gcagtctatgtcagtgaatttgatagaatgttgcttcgcttatatcaggtacttctctac
cttatccaaccgcttatctggttacgcctgctgttgcgcagccgtaaatcccctgcgtac
cgtaaacgctggggtgaacgttatggtttttgtgccaaaaaagtcgcaaaaggtggaata
ttactccattccgtttctgttggagaaacattggctgccattccattagtaagaatacta
cggcaccattatcctttcctgccgattaccgtgacaacaatgacaccaactggctctgaa
agggtgctttctgctttaggtactgatgtcaaccacgtttacctcccctatgatttgcct
ggctccatgagccgtttccttgataacgtcaaccccaagctggtgattattatggaaaca
gaattatggcccaatttgattacccaactgaaccaacgcgaaatccctctggtcattgcc
aatgcaaggttatcaacccgttcagcagcgggatatcaaaaaatcagcaactttattaaa
accattttaaataaaataacactgattgccgcacaaaatcaggaagatggtgagcgcttc
atcgaactcggcttaaaacgttcccaactcgccgtcactggcagcctgaaattcgacatt
tctgtcacgccagaactggcagcaaaagcggttacactgcgccgccaatgggcgccacat
cgtcctgtctggattgccaccagcacccatgatggagaagaaaccatcatattggatgcg
cactgcaaattaattcaacaatttcctgatctactgttaattctagtaccacgccatcct
gaacgttttaccaaggccgcagagttaacccaaaaagcgggattaaattcgatattaagg
agctctgacacaatacctgatcccaatgtgcaggtggttatcggagatactatgggcgaa
ttgatgctcttgtatggtatcgctgatctggcttttgtcggagggagtctggtcgagcgt
ggcggtcataatccactggaagccgcagctcatgccatccctgtcattatggggccacat
actttcaactttaaagatatttgtgccaagctggataaagccaatggccttatcgccgtt
acggatagtcactcgttgagtgccgctatcaatagcctgctgacagatgaggactatcgt
ctttattacggtcgccatgccgccgaagtcctgcacgaaaatcagggagcacttcagcga
ttgctaaaattactggaaccttatctcccgccacggggtcattga

DBGET integrated database retrieval system