KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0029Help
Entry
xccb100_0029      CDS       T00759                                 

Gene name
egl1
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31588..32637)
Genome map
AA seq 349 aa AA seqDB search
MSCSLWLRRLMSCAVFFLLLGVLPMGHAQTRALKYAGVNLAGAEFASSKKPGVLNKDYMY
PASTDYSYFAGTGMNVIRLPILWERLQPAARGELDPAQLALVQQAVARAKASGMYLVLDI
HNYSKYYGYKMGGPEVPLATFADLWRRLAVIFNSDNAVIFGLMNEPNNISASEWAGAAQA
GIDAIRATGANNLILVPGALWTGAHSWHSLTSDGYSNATALASISDPLNRYAFEVHQYLD
ADSSGTSSVCVSETIGADRLRAFTEWLRTNNKRGFLGEFGTANNAVCNTALQGMLAYMEN
YADVWLGWTWWAAGAWWNTSYAYNVHPNKDGTDKPQMVILSPQAARATR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgttctctgtggttgcgcaggctaatgtcctgcgcggtgttcttcctgctgctc
ggtgttctgccgatgggccatgcacaaacgcgtgcactcaagtacgccggcgtcaatttg
gcgggtgcggaatttgcgtcatcgaaaaaacctggcgtcctcaacaaggactacatgtat
cccgccagcaccgattacagctatttcgctgggactggaatgaacgtgattcgcctgccg
atcctgtgggaacgtctgcaacctgccgcacgcggcgagctggatccggcgcagctggca
ctggtgcagcaagcggtggcacgcgccaaggcatcgggcatgtatctggtgctggatatc
cacaactacagcaagtactacggttataaaatgggtgggccggaagtgccgctcgccacc
tttgccgatctgtggcggcgcctggcggtgatcttcaacagcgataacgccgtgatcttc
gggctgatgaatgagcccaacaacatctctgccagcgaatgggccggtgcagcgcaggca
ggcatcgatgcgatccgtgccaccggcgccaacaatctgatcctggtaccgggcgcgctg
tggaccggcgcacacagctggcactcgctgaccagcgatgggtattccaatgcaaccgcg
ttggcatcgatcagcgaccctctcaatcgctatgcgttcgaagtgcatcaatatctggat
gccgattccagcggcacctccagtgtctgcgtcagtgaaaccatcggcgccgatcgcctg
cgtgcgttcaccgaatggctacgcaccaacaacaagcgtggttttctcggtgagttcggc
accgccaacaacgccgtctgcaataccgcgctgcaaggcatgctggcctacatggaaaac
tacgccgatgtctggctgggctggacatggtgggcagcgggcgcatggtggaacaccagc
tacgcctacaacgtgcatccgaacaaggacggcaccgacaagccgcagatggtcatcctc
tcgccgcaggccgcgcgcgctacacgctga

DBGET integrated database retrieval system