KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0030Help
Entry
xccb100_0030      CDS       T00759                                 

Gene name
egl2
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(33046..34098)
Genome map
AA seq 350 aa AA seqDB search
MSASPSWPRQLLRCALVMLCIATMSIAQAQSPNRLKYAGVNISGAEIQSSKKPGVLNIDY
RYPTASEYRYFAGKQMNIVRLPILWERMQPKAQGPLDQAQLALLKQAVANAKAANQYLII
DVHNYVKYYGQKIGSKRVPVRTFTDLWRRLAIAFKSDNAVIFGLMNEPYDISPEGWAAAA
QASIDSIRATGATNLILVPGALWSGAHSWYSTVAGQSNAVALANIRDPLNRYAIEVHQYL
DTDSSGTSAGCVSRTIGAERLRSFTGWLRAQGKRGFLGEFGTANNATCTAALDGMLGYLE
TNHDVWIGWTFWAAGAWWNTSYPFNVQPDAQGRDKPQMKTLSARAHRVTR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctccccctcctggccacgccagctgctgcgctgcgcgttggtcatgctgtgc
atcgccacgatgtccatcgcacaggcgcaaagccccaatcgtctgaaatacgcaggcgtc
aacatctccggtgcggagatccagtcgtccaaaaaaccgggcgtgctcaatatcgactac
cgctatccaaccgcgtccgagtacaggtacttcgcgggcaagcaaatgaacatcgtgcgc
ctgccgatcctgtgggagcgcatgcagcccaaagctcaaggtccgctggatcaggcacaa
ctggcattgctgaagcaggcagtggccaacgccaaggccgccaatcaatacctgattatc
gatgtgcacaactacgtcaagtactacggccagaagattggcagtaagcgggtgccggtg
cgcacgttcaccgatctctggcgccgtctggccatcgcgttcaagagcgacaacgccgtg
attttcgggctgatgaacgagccgtacgacatctcgccagagggttgggccgccgccgcg
caggcgtccatcgacagcattcgtgccaccggtgccaccaacctgattctggtgcccggt
gcattgtggtcgggcgcacacagctggtattccaccgtggccgggcagtccaatgcagtg
gcgcttgcgaacatccgcgacccactgaatcgctatgcgatcgaagtccatcaatacctg
gataccgactccagcggcaccagtgccggttgtgtgagccgcacgatcggcgcggagcgc
ttgcgcagtttcaccggctggctgcgcgcgcaaggcaagcgcggttttcttggcgaattc
ggcaccgccaataacgcaacctgcactgcggcgctggacggcatgctcggttatctcgaa
accaaccacgatgtgtggatcggttggacgttctgggcggcaggcgcgtggtggaacacc
agctatccgttcaatgtgcagcccgatgcgcaaggccgcgacaagccgcagatgaaaacc
ttgagcgcacgcgcgcatcgcgtcacccgataa

DBGET integrated database retrieval system