KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0130Help
Entry
xccb100_0130      CDS       T00759                                 

Gene name
pme1
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    xccb100_0130 (pme1)
   00500 Starch and sucrose metabolism
    xccb100_0130 (pme1)
Enzymes [BR:xca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     xccb100_0130 (pme1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152374..153351
Genome map
AA seq 325 aa AA seqDB search
MQPHRRIVLRTLAASALLAGLSLGSGAAIAADPVYTVAKQGSAGYRTVQAAIDAAVQGGK
RAQINIGAGTYQELIVVPSNAPALKLTGAGATQTVITYDNYASRINPATGAAYGTSGSSS
VIIAGNDFTAEQLSFGNHAGPVGQAVAVRVDGDRAAFRNVRFLGYQDTLYLRGAKLSYFL
DCYVEGTVDFVFGAGTALFENVQLHSLGDGYLTAASTPQESARGFVFRNARVTAASGVSR
VHLGRPWRPYASVSFITSQLGAHIVPEGWNNWGNAANEATARYSEYQNTGAGANPSRRVK
WSRQLTAAQAAALDRSTVLGSWRPF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgcatcgcaggatcgtgttacgtactctcgctgccagcgcattgctggccggg
ctgtcgctcggcagcggcgccgccattgccgccgacccggtttacaccgtggccaagcag
ggcagcgccggctaccgcaccgtgcaggccgccatcgacgccgccgtacagggcggcaaa
cgcgcgcagatcaatatcggcgccggcacctatcaggagctgatcgtggtgccgtccaac
gcaccggcgctcaagctcaccggcgccggcgccacccaaaccgtcatcacctacgacaac
tacgcctcacgcatcaatccggccaccggcgctgcgtacggcacctccggctcgtccagc
gtcatcatcgccggcaacgacttcaccgccgagcaactgagcttcggcaaccacgcaggc
ccggtggggcaggcggtagcggtgcgcgtggatggcgaccgtgccgcgttccgcaacgtg
cgcttcctcggctaccaggacacgctgtacctgcgcggcgccaagctctcgtatttcctc
gactgctatgtcgaaggcaccgtggatttcgtcttcggcgccggcactgccctgttcgaa
aacgtgcagctgcattcgctgggcgatggctatctcaccgccgcctccaccccacaggaa
agcgcacgcggcttcgtattccgcaatgcccgcgtcaccgctgccagcggtgtctcgcgc
gtgcacctgggccggccgtggcggccgtacgccagcgtgagtttcatcactagccagctc
ggcgcgcacatcgtgcccgaaggctggaacaactggggcaacgcggccaacgaggccacc
gcccgctacagcgaataccagaacaccggcgccggggccaatccgtcgcgccgcgtgaaa
tggtcacgccagctcaccgccgcacaggccgctgcgctggaccgctccaccgtgctgggc
tcctggaggccgttctga

DBGET integrated database retrieval system