KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0181Help
Entry
xccb100_0181      CDS       T00759                                 

Definition
desaturase-like enzyme (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    xccb100_0181
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    xccb100_0181
Enzymes [BR:xca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     xccb100_0181
Lipid biosynthesis proteins [BR:xca01004]
 Desaturase
  First
   xccb100_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209297..210526
Genome map
AA seq 409 aa AA seqDB search
MAHCLEMPMLSDSIIDVLTSGIAGLGVWGMLAVLLVFTQLTIFAVTLYLHRSQAHRGVDF
HPVIAHFFRLWTWLTTSMITREWVAIHRKHHAKVETEEDPHSPQTKGIGQVFWRGVELYR
EARAQRADIEQYGKGAPNDWIERHLYTPHANAGPIALLVVNSVLFGLPGIALWAIQMAWI
PFWAAGVVNGLGHWWGYRNFESADTSTNLTPWALWIGGEELHNNHHAFPSSARFSMRRWE
LDIGWIAIRCLQALGLAKVLRVAPSLDIRPNIAVPDADTLKALLSHRFQAMTDYQRNVLK
PALREEAAATGAKLRQLLPRRLRKGLVDDGRWLKPDAREQLQHWVAQRPRMRTLVEYRAR
LTAVLEARSHDASERLKQLQQWCHEAEASGNAALQAYAARLKGYALSGT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactgcctggagatgccgatgttgtccgattcgatcatcgacgttctgacctcc
ggcatcgccggcctgggcgtgtgggggatgctggccgtgctgctggtgttcacccaactc
accatcttcgcggtgaccttgtacctgcatcgcagccaggcgcaccgcggtgtggatttc
cacccggtcatcgcgcatttcttccgtttatggacctggctcaccacctcgatgatcacc
cgcgagtgggtggcgatccatcgcaagcatcacgccaaggtggaaaccgaggaagacccg
cacagcccgcagaccaagggcatcggccaggtgttctggcgcggcgtggagctgtaccgc
gaagcacgcgcgcagcgggccgacatcgagcagtacggcaagggcgcgcccaatgactgg
atcgagcggcatctgtacacgccgcacgccaacgccggcccgatcgcgctgttggtggtg
aacagcgtgctgttcgggctgcccggtatcgcactgtgggcgatccagatggcgtggatt
ccgttctgggccgccggcgtggtcaatggcctggggcattggtggggctatcgcaatttc
gagtccgccgacacctccaccaacctgaccccgtgggcgctctggatcggtggcgaagaa
ctgcacaacaatcaccacgccttcccgagttcggcgcggttttcgatgcggcgctgggag
ctggacatcggctggatcgcgatccgctgcctgcaggcgctgggcctggccaaggtgctg
cgggtggcgccatcgctggacatccgcccgaatatcgctgtgcccgatgccgatacgctc
aaggcgctgttgtcgcaccgcttccaggccatgaccgactaccagcgcaacgtgctcaag
ccggccctgcgcgaagaggccgccgccaccggtgccaagctgcgccagctgctgccgcgc
cgcctgcgcaagggcctggtggacgatggccgctggctcaagcccgatgcgcgcgaacaa
ttgcaacactgggtggcgcaacgcccgcgcatgcgcacgctggtggaataccgcgcgcgc
ctcaccgccgtgctggaagcgcgcagccacgatgcgtccgagcggctcaagcagctgcag
cagtggtgccatgaagccgaagccagcggcaacgcggcattgcaggcgtatgcggcacgg
ctcaagggttatgcgctgagtggcacgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system