KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0259Help
Entry
xccb100_0259      CDS       T00759                                 

Gene name
aceB
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_0259 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    xccb100_0259 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    xccb100_0259 (aceB)
Enzymes [BR:xca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     xccb100_0259 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
290320..291942
Genome map
AA seq 540 aa AA seqDB search
MSATAASARPTAADRATPGVSLTTQLAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRR
SRQAAFDAGQLPDFRTDTRTIRAGDWRVAELPAALQDRRVEITGPTDPKMVINALNSGAK
VFMADFEDSTAPTWRNLLIGQRTLAAAVRGELTFDAPNGKHYALRPEHERAVLIVRPRGW
HLDEKHVLIDGQPMAGGLFDAALFAFHNARTLMAKDRGPYLYLPKLQSMEEAALWETALA
HIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRARIVGLNCGRWDYIFSYLKTFRAH
PDRVLPERGQVTMTQPFLKAYSEMLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARV
RADKLREVSAGHDGTWVAHPALIPVAMAVFDEHMPTAHQHHVLRNDVHITSDMLIATPPG
GITRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRAQLWQWLHHGRHLDDG
TAIDQHLLDTTLRQLPARLGATAGMPGGARIAEAIGLLDQLSRAEELADFLTVPAYRLID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccgccgcttccgcccgtcccaccgccgctgaccgtgccacccccggcgtg
tcgctgaccacccagctggcgggtcaggccgagctgctccccgctgccgcgctggccctg
ctggtgtcgctgcaccgggcgatcgagcccggccgccagcagcggctggcccagcgtcgc
agccgccaggccgcgttcgacgccggccagttgcccgactttcgcaccgacacccgtacc
atccgcgccggcgactggcgcgtggccgaactgccggccgccctgcaggaccgccgggtc
gagatcaccggccccaccgatccgaagatggtcatcaacgcgctgaactccggcgccaag
gtgttcatggccgacttcgaagattccaccgcgcctacctggcgcaacctgctgatcggg
cagcgcacgttggcggcggcggtccgcggcgagctgacgttcgacgcgcccaacggcaag
cactacgcgctgcgtccggaacacgaacgtgcggtgctgatcgtgcgcccgcgtggctgg
cacctggacgaaaagcacgtgttgatcgatggccagccgatggccggcggcttgttcgat
gcggcgctgttcgccttccacaacgcacgtacgctgatggccaaggaccgcggcccgtac
ctgtatctgcccaagttgcagagcatggaagaagccgcgctgtgggagaccgcgctggcg
catatcgaagcgatgctcggcctgccgcacgggcagatcaaggtcaccgtgctgatcgaa
acgctgccggcggtgttcgagatggacgagatcctgcacgccttgcgcgcacgcatcgtc
gggctcaattgcggccgttgggactacatcttttcgtacctgaaaacctttcgcgcacat
ccggaccgcgtgctgcccgagcgtggccaggtcaccatgacccagccgtttctcaaggcg
tattcggaaatgctgatcaagacctgccatcgtcgcggcgcgcatgcaatgggcggcatg
gccgcgcagattccaatcaaccacgacgaggccgccaacgaacaggccatggcgcgcgtg
cgtgccgacaagctgcgcgaggtcagtgccggccatgacggcacctgggtggcgcacccg
gcactgattccggtggcgatggcggtgttcgacgagcacatgcccaccgcgcatcaacac
catgtgctgcgcaacgatgtgcacatcacctccgacatgttgattgccacaccgcccggc
ggcatcacccgcgccggtttcgagggcaatgtcgaggtctgcgtgcgttacctggccgcg
tggctggacggcaatggctgcgtgcccatccataacctgatggaagatgcggccactgcg
gaaatcagccgcgcgcaactgtggcagtggctgcatcacggccgccatctcgatgacggc
accgccatcgatcaacacctgctcgataccactctgcggcagttgccggcgcgcctgggc
gccactgctggcatgccgggcggcgcacgtatcgccgaggccatcggcttgctcgaccaa
ctgagccgcgccgaggaattggccgacttcctcacggttccagcgtatcgcctgatcgac
tga

DBGET integrated database retrieval system