KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0259Help
Entry
xccb100_0259      CDS       T00759                                 

Gene name
aceB
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:xca01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:xca00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:xca00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
290320..291942
Genome map
AA seq 540 aa AA seqDB search
MSATAASARPTAADRATPGVSLTTQLAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRR
SRQAAFDAGQLPDFRTDTRTIRAGDWRVAELPAALQDRRVEITGPTDPKMVINALNSGAK
VFMADFEDSTAPTWRNLLIGQRTLAAAVRGELTFDAPNGKHYALRPEHERAVLIVRPRGW
HLDEKHVLIDGQPMAGGLFDAALFAFHNARTLMAKDRGPYLYLPKLQSMEEAALWETALA
HIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRARIVGLNCGRWDYIFSYLKTFRAH
PDRVLPERGQVTMTQPFLKAYSEMLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARV
RADKLREVSAGHDGTWVAHPALIPVAMAVFDEHMPTAHQHHVLRNDVHITSDMLIATPPG
GITRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRAQLWQWLHHGRHLDDG
TAIDQHLLDTTLRQLPARLGATAGMPGGARIAEAIGLLDQLSRAEELADFLTVPAYRLID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccgccgcttccgcccgtcccaccgccgctgaccgtgccacccccggcgtg
tcgctgaccacccagctggcgggtcaggccgagctgctccccgctgccgcgctggccctg
ctggtgtcgctgcaccgggcgatcgagcccggccgccagcagcggctggcccagcgtcgc
agccgccaggccgcgttcgacgccggccagttgcccgactttcgcaccgacacccgtacc
atccgcgccggcgactggcgcgtggccgaactgccggccgccctgcaggaccgccgggtc
gagatcaccggccccaccgatccgaagatggtcatcaacgcgctgaactccggcgccaag
gtgttcatggccgacttcgaagattccaccgcgcctacctggcgcaacctgctgatcggg
cagcgcacgttggcggcggcggtccgcggcgagctgacgttcgacgcgcccaacggcaag
cactacgcgctgcgtccggaacacgaacgtgcggtgctgatcgtgcgcccgcgtggctgg
cacctggacgaaaagcacgtgttgatcgatggccagccgatggccggcggcttgttcgat
gcggcgctgttcgccttccacaacgcacgtacgctgatggccaaggaccgcggcccgtac
ctgtatctgcccaagttgcagagcatggaagaagccgcgctgtgggagaccgcgctggcg
catatcgaagcgatgctcggcctgccgcacgggcagatcaaggtcaccgtgctgatcgaa
acgctgccggcggtgttcgagatggacgagatcctgcacgccttgcgcgcacgcatcgtc
gggctcaattgcggccgttgggactacatcttttcgtacctgaaaacctttcgcgcacat
ccggaccgcgtgctgcccgagcgtggccaggtcaccatgacccagccgtttctcaaggcg
tattcggaaatgctgatcaagacctgccatcgtcgcggcgcgcatgcaatgggcggcatg
gccgcgcagattccaatcaaccacgacgaggccgccaacgaacaggccatggcgcgcgtg
cgtgccgacaagctgcgcgaggtcagtgccggccatgacggcacctgggtggcgcacccg
gcactgattccggtggcgatggcggtgttcgacgagcacatgcccaccgcgcatcaacac
catgtgctgcgcaacgatgtgcacatcacctccgacatgttgattgccacaccgcccggc
ggcatcacccgcgccggtttcgagggcaatgtcgaggtctgcgtgcgttacctggccgcg
tggctggacggcaatggctgcgtgcccatccataacctgatggaagatgcggccactgcg
gaaatcagccgcgcgcaactgtggcagtggctgcatcacggccgccatctcgatgacggc
accgccatcgatcaacacctgctcgataccactctgcggcagttgccggcgcgcctgggc
gccactgctggcatgccgggcggcgcacgtatcgccgaggccatcggcttgctcgaccaa
ctgagccgcgccgaggaattggccgacttcctcacggttccagcgtatcgcctgatcgac
tga

DBGET integrated database retrieval system