KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0260Help
Entry
xccb100_0260      CDS       T00759                                 

Gene name
aceA
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_0260 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    xccb100_0260 (aceA)
Enzymes [BR:xca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     xccb100_0260 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292118..293413
Genome map
AA seq 431 aa AA seqDB search
MSTPLQTAEQIQHDWATHPRWAGITRNYSAADVVRLRGTVHVEHSLARLGADKLWTSLHA
TPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGDDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDD
NDRGFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADVIWCETGKPDLEFARAFAQAIHA
KFPGKLLAYNCSPSFNWKKNLDDATIARFQTELASYGYKFQFITLAGFHALNYGMFHLAH
GYARSQMSAFVELQQAEFAAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEAQFHGEKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccgctgcagaccgccgaacagattcagcatgactgggccacccacccgcgc
tgggccggcatcacccgcaattacagcgccgccgatgtggtgcgcctgcgcggcaccgtg
cacgtcgagcattcgctggcacggctgggcgcggacaaactctggacatcgctgcatgcc
acgcccttcgtcaacgccttgggcgcgctcaccggcaaccaggcgatgcagcaggtcaag
gccggcttgaaggcgatctatctctccggttggcaggtggcggccgacgccaatctggcc
gggcagatgtatccggaccaatcgctgtacccggccgattcggtgccggcggtggtcaag
cgcatcaacaacaccttgctgcgcgccgatcagttgcaccatgccgaaggcgatgatgcg
atcgacttcctgcagccgatcgtggccgatgccgaagccggtttcggtggcgtgctcaat
gccttcgaactgatgaaggcgatgatcgaagctggcgcggccggcgtgcatttcgaggac
cagttggcctcggtgaaaaaatgcggacacatggggggcaaggtattggtgcccacccgc
gaggcgatcgagaaattgaatgccgcgcggctggccgccgatgtgctgggcgtgcccacc
gtcttgatcgcacgcaccgacgccgaagccgccgacctgatcaccagcgacgtggacgac
aacgaccgcggtttcaccaccggcgagcgcacggtggaaggcttcttcaagacccgcaac
ggcctggaccaggccatcagccgcggcctggcctatgcgccgtacgcggatgtgatctgg
tgcgaaaccggcaagccggacctggagtttgcccgcgcctttgcgcaagccatccatgcc
aagttccccggcaagctgctggcctacaactgctcgcccagcttcaactggaagaagaac
ctggacgacgccaccatcgccaggttccagaccgaactggccagttatggctacaagttc
cagttcatcaccctggccggcttccacgcgctgaattacggtatgttccacctcgcccat
ggctatgcgcgcagccagatgagtgcctttgtcgagctgcagcaagccgaatttgcggcc
gcagagcgtggcttcactgcggtcaagcaccagcgcgaagtgggcaccggctacttcgat
gcagtgacgcaggcgatccagcaggggcagtcctcgaccaccgcgttgcgtggctccacc
gaagaagcacagtttcacggcgagaaggcggcttag

DBGET integrated database retrieval system