KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0260Help
Entry
xccb100_0260      CDS       T00759                                 

Gene name
aceA
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_0260 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    xccb100_0260 (aceA)
Enzymes [BR:xca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     xccb100_0260 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292118..293413
Genome map
AA seq 431 aa AA seqDB search
MSTPLQTAEQIQHDWATHPRWAGITRNYSAADVVRLRGTVHVEHSLARLGADKLWTSLHA
TPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGDDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDD
NDRGFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADVIWCETGKPDLEFARAFAQAIHA
KFPGKLLAYNCSPSFNWKKNLDDATIARFQTELASYGYKFQFITLAGFHALNYGMFHLAH
GYARSQMSAFVELQQAEFAAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEAQFHGEKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccgctgcagaccgccgaacagattcagcatgactgggccacccacccgcgc
tgggccggcatcacccgcaattacagcgccgccgatgtggtgcgcctgcgcggcaccgtg
cacgtcgagcattcgctggcacggctgggcgcggacaaactctggacatcgctgcatgcc
acgcccttcgtcaacgccttgggcgcgctcaccggcaaccaggcgatgcagcaggtcaag
gccggcttgaaggcgatctatctctccggttggcaggtggcggccgacgccaatctggcc
gggcagatgtatccggaccaatcgctgtacccggccgattcggtgccggcggtggtcaag
cgcatcaacaacaccttgctgcgcgccgatcagttgcaccatgccgaaggcgatgatgcg
atcgacttcctgcagccgatcgtggccgatgccgaagccggtttcggtggcgtgctcaat
gccttcgaactgatgaaggcgatgatcgaagctggcgcggccggcgtgcatttcgaggac
cagttggcctcggtgaaaaaatgcggacacatggggggcaaggtattggtgcccacccgc
gaggcgatcgagaaattgaatgccgcgcggctggccgccgatgtgctgggcgtgcccacc
gtcttgatcgcacgcaccgacgccgaagccgccgacctgatcaccagcgacgtggacgac
aacgaccgcggtttcaccaccggcgagcgcacggtggaaggcttcttcaagacccgcaac
ggcctggaccaggccatcagccgcggcctggcctatgcgccgtacgcggatgtgatctgg
tgcgaaaccggcaagccggacctggagtttgcccgcgcctttgcgcaagccatccatgcc
aagttccccggcaagctgctggcctacaactgctcgcccagcttcaactggaagaagaac
ctggacgacgccaccatcgccaggttccagaccgaactggccagttatggctacaagttc
cagttcatcaccctggccggcttccacgcgctgaattacggtatgttccacctcgcccat
ggctatgcgcgcagccagatgagtgcctttgtcgagctgcagcaagccgaatttgcggcc
gcagagcgtggcttcactgcggtcaagcaccagcgcgaagtgggcaccggctacttcgat
gcagtgacgcaggcgatccagcaggggcagtcctcgaccaccgcgttgcgtggctccacc
gaagaagcacagtttcacggcgagaaggcggcttag

DBGET integrated database retrieval system