KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0384Help
Entry
xccb100_0384      CDS       T00759                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    xccb100_0384 (glpK)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    xccb100_0384 (glpK)
Enzymes [BR:xca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     xccb100_0384 (glpK)
Exosome [BR:xca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   xccb100_0384 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(417485..418984)
Genome map
AA seq 499 aa AA seqDB search
MEKKYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWVEHNPREIMTSVYTTI
TELLNNAQIDAREISGIGITNQRETAVVWDKATGQPIYNAIVWQSRQTKDICTQLKEAGH
EQMVRDKTGLLIDAYFSGTKVKWILDHVDGARERARKGELAFGTIDSWLIWNLTGGKVHV
TDYTNASRTMMYNIHTLEWDAELLEMLDVPAQMLPEVRSSSEVYGMTQTQYFYGEQVPIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMNTGDKAVASKAGLLTTIAWGIDGKVEY
ALEGAIFVAGSVVQWLRDGLRMFGKASDSQAYAERAGDNDGVYFVPAFVGLGAPYWRSDI
RGAVFGLTRGTSKEHFVRAAVESMAYQTRDVLTAMQSDSGIELKELRADGGAIANDFMAQ
FQSDILNVPVLRPEVAETTALGAAYLAGLATGFWSSREEIAKQWAVDRRFEPNMPEERRE
QLYAGWQQAVEATMGFRIS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatacgtccttgcgatcgaccagggcaccaccagctcgcgcgcgatgttg
ttcgatcgccagggcaaggtggccggcgtggcgcagcgcgaattcggccagatctttccg
cagccgggctgggtggaacacaacccacgcgagatcatgaccagcgtctacaccaccatt
accgagctgctcaacaacgcgcagatcgacgcgcgcgagatctcaggcatcggcatcacc
aaccagcgcgagaccgcggtggtatgggacaaggccaccggccaaccgatctacaacgcc
atcgtctggcaatcgcggcagaccaaggacatctgcacccagctcaaggaggccggccat
gagcagatggtgcgcgacaagaccgggctgctgatcgatgcgtatttttccggcaccaag
gtcaagtggattctcgaccacgtggacggcgcacgtgaacgcgcacgcaagggcgagctc
gccttcggcaccatcgatagctggctgatctggaacctcaccggcggcaaggtgcacgtg
accgactacaccaatgcctcgcgcaccatgatgtacaacatccacaccctggagtgggat
gccgagctactggagatgctggacgtgcccgcgcagatgctgccggaagtgcgctcttcc
agcgaggtctatggcatgacccagacccagtacttttacggcgaacaggtgcccattgcc
ggcattgccggcgaccagcaggccgcattgttcgggcaagcgtgctttgaaccgggcatg
gccaagaacacctatggcaccggctgtttcatgctgatgaataccggcgacaaggccgtg
gcctccaaggccggcttgctgaccaccatcgcctggggcatcgacggcaaggtggaatac
gcactggaaggcgccatcttcgtggctggctcggtggtgcagtggctgcgcgatgggctg
cgcatgttcggcaaggcgagcgattcgcaagcctatgcggagcgtgccggcgacaacgac
ggcgtgtatttcgtcccggccttcgtgggcctgggcgcaccgtactggcgcagcgatatc
cgcggtgcggtgttcggcctgacccgcggcaccagcaaggaacacttcgtgcgcgcggcg
gtggaatcgatggcctaccagacccgcgatgtgctcaccgcgatgcagagcgattcgggg
atcgaactgaaggagctgcgcgccgacggtggcgcgatcgccaacgacttcatggcgcaa
ttccagagcgacattctcaacgtgccggtgctgcgtccggaggtggccgaaaccaccgcg
ctgggcgcggcctacctggcgggcctggccaccgggttctggagcagccgcgaagagatc
gccaaacaatgggcggtggatcgccgcttcgagccgaacatgcccgaagagcggcgcgaa
cagttgtatgccggctggcagcaggcagtggaagccaccatgggcttccgcatcagctaa

DBGET integrated database retrieval system