KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0441Help
Entry
xccb100_0441      CDS       T00759                                 

Gene name
glgB2
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    xccb100_0441 (glgB2)
Enzymes [BR:xca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     xccb100_0441 (glgB2)
Exosome [BR:xca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   xccb100_0441 (glgB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481504..483738
Genome map
AA seq 744 aa AA seqDB search
MSERLGVHGRDAEQEMAEGGGGSAVALQDLQAIAAGLPGDAFAVLGPHVQADGRLRVRVL
APGAEALGLIDGRGKLLARMQASPIDGVFEGELPAEAAYRLRIVWPDVVQEIEDPYAFAP
QIDESALLQIAAGDGQALRANLGARHVQVGEVPTVRFAVWAPHAQRVAVVGDFNGWEPRR
HPMRQRSGGIWELVLPRVETGARYKYAITTADGRVLLKADPVARQSELPPATASVVASAD
AFAWTDAEWMARRSAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAAQLIPYVQELGFT
HIELLPITEHPFGGSWGYQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFP
DDAHGLSQFDGSATYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSAMEWIAHYHLDGL
RVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLTGEIASQFPGVLTIAEESTA
WPGVTAPISEGGLGFTHKWNMGWMHDTLHYMQRDPAARAQHHSQLTFGLVYAFSERFVLP
LSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDR
SLDWHLLDHAPHRGMQQLVRDLNRALRRVPALYRGNHRADGFEWSVADDARNSVLAFIRH
DPDGGAPLLAVSNLTPQPHHDYRVGVPRAGGWREILNTDSAHYGGSNLGNGGRLLTEPTG
MHGHAQSLRLTLPPLATIYLQAEK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacggttgggcgtgcacggccgggacgcggagcaggagatggcggaaggcggc
ggagggagcgccgtagcactgcaggacctgcaggcgatcgccgccgggctccccggcgac
gcctttgcggtgttggggccgcacgtgcaggccgatggccgcttgcgtgtgcgggtcctg
gcgcccggcgccgaggctttggggctgatcgatggccgcggcaagttgctggcccgcatg
caggccagcccgatcgacggtgtgttcgaaggcgaactgccggcagaggccgcgtaccgc
ctgcgcatcgtctggccggacgtggtgcaggagatcgaagacccatacgcgtttgcgccg
cagatcgatgaatcggcgctgctgcagattgctgccggcgacggccaggcgctgcgcgcc
aacctgggcgcgcggcatgtgcaggttggcgaggtgcccacggtgcgttttgcggtgtgg
gcgccgcatgcccagcgcgtggcagtggtgggcgacttcaacggttgggagccacgccgc
cacccgatgcgccagcgcagcggcggcatctgggagctggtgctgccacgcgtggagacc
ggcgcgcgctacaagtacgccatcaccaccgccgatggccgggtcttgctcaaggccgac
ccggtggcccgccaaagcgagttgccaccggccaccgcctcggtagtggccagtgcggat
gcgtttgcctggaccgatgccgagtggatggcacgccgcagcgccgctgccgagccggcg
ccgctgtcgatctatgaagtgcacgctgcctcctggcgccgcgacggccacgatcagccg
ctggactgggtgtcgctggcggcgcagttgatcccgtacgttcaggagctgggcttcacc
catatcgaactactgccgatcaccgagcacccgttcggcggctcgtggggctatcagccg
ctgggcttgtacgcgcccactgcaaggcacggcagcccggacgggtttgcccagttcgtc
gatgcgtgccaccgcgccggcatcggcgtgatcctggactgggtcagcgcgcactttccc
gatgatgcacatgggctgagccagttcgacggcagtgccacctacgagcacgccgacccg
cgcgagggcatgcatcgcgactggaatacgctgatctacaactacggccggcccgaggtc
accgcgtatctgctcggcagtgcgatggagtggattgcgcattaccacctcgatggcctg
cgcgtggatgcggtggcctcgatgctctaccgcgactacggccgtgccgagggcgagtgg
gtgcccaacgcccacggcgggcgcgagaacctggaggctgtggcgttcctgcgccagctc
accggcgagatcgccagccagttccccggcgtgctgaccattgccgaggaatccaccgcc
tggccgggcgtgaccgcgccgatcagcgaaggcgggctgggctttacgcataagtggaac
atgggctggatgcacgacacgctgcactacatgcagcgcgacccggccgcgcgcgcccag
caccatagccagctgaccttcgggctggtgtacgcgttttccgagaggttcgtgctgccg
ctgtcgcatgacgaagtggtgcacggcaccggcggcctgcttggccagatgcccggcgac
gactggcgccgctttgccaacctgcgcgcctacctggcgttgatgtgggcgcacccgggc
gacaagttgctgttcatgggcgccgaattcggccagtgggcggactggaatcacgaccgc
tcgctggactggcacctgctcgatcacgcgccgcatcgcggcatgcaacagctggtgcgc
gatctcaaccgcgccttgcgccgcgtgcctgcgttgtaccgcggcaaccaccgtgccgat
ggcttcgagtggagcgtggccgacgatgcgcgcaacagcgtgctggccttcattcgtcac
gaccccgacggcggcgcgccgctgctggcagtgagcaacctcaccccgcagccgcaccac
gactaccgcgtcggcgtgccgcgtgccggcggctggcgcgaaatcctcaataccgacagt
gcccattacggcggcagcaatcttggcaatggcggtcgtctgctgaccgaaccgaccggg
atgcatggccacgcgcaaagcctgcgcctgacgctgccgccgctggccacgatctacctg
caagcggagaaatga

DBGET integrated database retrieval system