KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0443Help
Entry
xccb100_0443      CDS       T00759                                 

Gene name
malQ
Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    xccb100_0443 (malQ)
Enzymes [BR:xca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     xccb100_0443 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485494..487425
Genome map
AA seq 643 aa AA seqDB search
MSTQELHALAAAAGVMVDWVDASDQPRQVAPESIHAVLTALELPAASAAQRADSLQRIRA
TAAEPAPLVTVKVGGPLPLQVAPNAQGRWQAEDGSSEAARADAQGRLLAPARFGYWTLEL
GTTAQQVAVAPQRCFSVADACGQPAPRAWGMALQVYSARSADDGGIGDAAGAMEWVRQAA
GANADALALSPVHASRPITGGYSPYSPSDRRFLDPLHAAPVRVLGDAVDTAIAAVPGLRE
RLDGLHGTALIDWPASAAAKWELLRQLSTQVTPDHPELAAFRAQGGAALEAFAHFAARDF
GDGDAHLHVFTQWLAARSWADVQREAHERGMRIGLIADLAVGFDPNGAEAAAAADTVLRG
LVLGAPPDAFNADGQHWGIGAYSPTALRRSGFAPYIALLRAVLRDRGGIRIDHILGLLRL
WVVPDGASSGDGAYLAYPLQDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSRRGVMG
IDVLMFTRDQEGAFVPPALWRADAVATTTTHDLPTLTGWRAGRDIDWRRTLELIQPAQAQ
ADHQTRIRDASRLDAAVADAGLGSDAPLLDALRFTASSVSPLALLPVEDALALDEQPNLP
GTVEVHPNWRRRLPDPLPQAQLTAALQGFAEARRVSAVSEPHP
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaggaactgcatgccctggccgccgcggccggggtgatggtggattgggtg
gacgccagcgaccagccgcgccaggtggcgccggagtcgatccatgccgtgctcaccgcg
ctggaattgcccgccgccagcgccgcgcagcgtgccgacagcctgcagcgcatccgcgcc
actgccgccgagccggcgccgctggtgacggtgaaggtgggcgggcccttgccgttgcag
gttgcgcccaacgcacagggccgctggcaggccgaagacggcagcagcgaggccgcgcgg
gccgatgcgcagggccggctgttggcgccggcgcgctttggctactggacgctggaactg
ggcaccacggcccagcaggtggccgtggcgccgcagcgctgcttcagcgtggccgacgcc
tgtggccagccggcgccgcgtgcgtggggcatggcgctgcaggtgtattcggcccgcagc
gccgacgatggcggcattggcgatgcggccggagccatggagtgggtgcggcaggccgcc
ggcgccaatgccgatgcgttggcgctgagcccggtgcatgcctcgcgcccgatcaccggc
ggctacagcccgtattcgcccagcgaccggcggttcctggaccccttgcacgccgcaccg
gtgcgcgtgctgggcgatgccgtggacacggcgattgctgccgtgcccggcctgcgcgag
cgcctggacgggctgcatggcaccgcattgatcgactggccggcctcggccgctgccaag
tgggaactgctgcgccagctgtccacccaggtgacgccggaccacccggagctggcggcg
tttcgcgctcagggtggcgcggcgctggaggcgtttgcacacttcgccgcgcgcgacttc
ggcgatggcgatgcgcacctgcatgtgttcacccaatggctggccgcccgcagctgggcc
gacgtgcaacgtgaagcgcacgaacgcggcatgcggatcggcctgatcgccgacctggcg
gtgggctttgatccgaacggtgccgaggccgccgccgcggccgacaccgtgctgcgcggg
ctggtgctgggcgcgccgccggacgccttcaatgccgatggccagcattggggcatcggt
gcgtactcgcccaccgcgctgcgccgtagcgggtttgcgccgtatatcgcgctgctgcgt
gcggtgctgcgcgaccgcggcggcatccgcatcgatcacatcctgggcctgctgcggctg
tgggtggtgcccgatggcgccagctccggcgatggcgcctacctggcgtatccgctgcag
gacctgctcaacctgctcgcgctggaatcctggcggcatcgcgccatcgtgattggcgaa
gacctgggcgtggtgccgccgggcatccgcgaagagctctcgcgtcgcggcgtgatgggc
atcgacgtgctgatgttcacccgcgaccaggagggtgccttcgtgccgccggcgctgtgg
cgtgcggacgcggtggccacgaccaccacccatgacctgcccaccctgaccggctggcgc
gccggccgcgacatcgactggcgccgcacgctcgagctgatccagcccgcgcaggcgcag
gccgaccaccagacgcgcatccgtgacgcttcgcgcctggacgcggccgtggccgacgcc
ggcctgggcagcgatgcgccgttgctggatgcgctgcgcttcaccgccagcagtgtgtcg
ccgctggccctgctgccggtggaagacgcgctggcgctggacgaacaacccaatctgccg
ggcaccgtcgaggtccatcccaattggcgccgacgcctgcccgaccccttgccccaggcg
cagctgaccgccgcgctgcagggttttgccgaggcgcgccgcgtctcggccgtttcggaa
ccgcatccatga

DBGET integrated database retrieval system