KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0675Help
Entry
xccb100_0675      CDS       T00759                                 

Gene name
engXCA
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    xccb100_0675 (engXCA)
Enzymes [BR:xca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     xccb100_0675 (engXCA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(758194..759648)
Genome map
AA seq 484 aa AA seqDB search
MSIFRTASTLALATALALAAGPAFSYSINNSRQIVDDSGKVVQLKGVNVFGFETGNHVMH
GLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPASIDYSRNADLQGLTSLQILDKV
IAEFNARGMYVLLDHHTPDCAGISELWYTGSYTEAQWLADLRFVANRYKNVPYVLGLDLK
NEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWLIAVEGITDNPVCSTNGGIFWGGN
LQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWERHFGQFAGTHALL
LGEFGGKYGEGDARDKTWQDALVKYLRSKGINQGFYWSWNPNSGDTGGILRDDWTSVRQD
KMTLLRTLWGTAGNTTPTPTPTPTPTPTPTPTPTPTPTPGTSTFSTKVIVDNSWNGGYCN
RVQVTNTGTASGTWSIAVPVTGTVNNAWNATWSQSGSTLRASGVDFNRTLAAGATAEFGF
CAAS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtccatattcaggaccgcaagcacgctcgctttggccaccgccctcgcactggccgcc
gggccggccttcagctattccatcaacaacagcaggcagatcgtcgacgacagcggcaag
gtcgtgcagctcaagggtgtgaacgtgttcggcttcgaaaccggcaaccacgtgatgcat
ggcctgtgggcacgcaactggaaggacatgatcgtgcagatgcagggcctgggcttcaac
gccgtgcgcctgccgttctgcccggccacgctgcgtagcgacaccatgccggccagcatc
gactacagccgcaacgccgacctgcagggcctgacctcgctgcagatcctcgacaaggtg
atcgccgaattcaatgcgcgcggcatgtatgtgctgctggatcaccacacccccgattgc
gccggcatttccgagctctggtacaccggctcctataccgaggcacagtggctggccgac
ctgcgctttgtggccaaccgctacaagaacgtgccgtatgtactcggcctggatctgaag
aacgaaccgcacggcgccgccacctggggtaccggcaacgccgccaccgattggaacaag
gctgccgagcgcggctcggccgcggtgttggcggtcgcgccgaaatggctgatcgcggtg
gaaggcatcaccgacaacccggtgtgctccaccaacggcggcatcttctggggcggcaac
ctgcagccgctggcctgcaccccgctcaacatcccggccaaccgcctgctgctggccccg
cacgtgtacggcccggacgtgttcgtgcagtcgtacttcaacgacagcaacttccccaac
aacatgcccgccatctgggaacgccatttcggtcagttcgccggcacgcatgcgctgttg
ctgggcgagttcggtggcaagtacggcgaaggcgacgcacgcgacaagacctggcaggac
gcgctggtgaagtacctgcgcagcaagggcatcaaccagggcttctactggtcgtggaat
cccaacagcggcgacaccggcggcatcctgcgcgatgactggaccagcgtgcgccaggac
aagatgaccctgctgcgcacgctgtggggcaccgccggcaataccacgccgacgccgact
cccacacctacgcccacaccgacaccgacgcctacccccacgccgacgcccaccccgggc
accagcaccttcagcaccaaggtgatcgtggacaacagctggaacggcggctattgcaac
cgcgtgcaggtgaccaacaccggcaccgccagcggcacctggtcgatcgcggtgccggtc
accggtacggtcaacaacgcctggaatgcgacctggtcgcagagcggcagcacgctcaga
gccagcggcgtggacttcaaccgcaccctggcagccggcgccaccgccgagttcggcttc
tgcgccgcgagctga

DBGET integrated database retrieval system