KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0764Help
Entry
xccb100_0764      CDS       T00759                                 

Gene name
folK1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863887..864393
Genome map
AA seq 168 aa AA seqDB search
MTTVLLSLGSNVQPTHYLRLAVEALRARFGPIDVSPAYRTAAVGFDGPDFVNNGVQLQTD
WELQALDDWLHALEDRHGRDRSGPRFSDRTLDVDVVFFGDRIVEGPGHLRVPRPELKHAF
VLKPLADIAPAFVDPLSGKTLAALWQAHPQYGSAFTTVELDNAVALPQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtgctcctcagcctgggcagcaacgtccagccaacccattacctgcgcctg
gccgtcgaggccttgcgcgcgcgttttggcccgatcgacgtctcgccggcgtatcgcacc
gcggcggttggtttcgatggcccggacttcgtcaacaacggcgtgcaactgcagaccgat
tgggagttgcaggcgctggacgactggttgcatgcgctggaagaccgccatggccgcgat
cgcagcgggccgcgtttcagcgaccgcacgctggatgtggacgtggtgtttttcggcgac
cgcatcgtggaagggccgggccacctgcgcgtgccacggcccgagctcaagcatgcgttc
gtgctcaagccgttggctgacattgcgccagcattcgtcgatccgctgagcggcaagacc
ctggcggcgttgtggcaggcgcatccgcaatacggcagcgcgttcaccacggtggaactg
gacaacgcggtggcattgccgcagtaa

DBGET integrated database retrieval system