KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0861Help
Entry
xccb100_0861      CDS       T00759                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
Enzymes [BR:xca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     xccb100_0861 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(983739..984395)
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVEIPLSAGH
KMMKPVVEGRMLQALDLQPGEDVLEVGTGSGFSTACLAALAREVVSLEIDPALAAAARAN
LDATGLGSNVRIETADVFAWQSERRFDAICVTGAVDTVPTQWLQWLRPNGRLFVVRGHDP
VMEAVLVRGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggtcgaacagcagatccggccgtgg
gatgtgctggacctgcgcgtgctcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcctacaagaccctggcctacgtcgatgtggaaattccgctgtcggccggccac
aagatgatgaagccggtggtcgaaggccgcatgttgcaggccctggatctgcagcccggc
gaagacgtgcttgaagtgggcaccggcagcggcttctccaccgcctgcctggccgcactg
gcccgcgaagtggtgagcctggagatcgaccccgcgctggccgccgccgcgcgtgccaac
ctggacgccaccggtctgggcagcaatgtccgcatcgaaaccgccgacgtgttcgcctgg
cagagcgagcgtcgcttcgacgccatctgcgtgaccggcgcggtcgatacggtgccgacc
cagtggctgcagtggctgcgcccgaacggacggctgtttgtggtgcgcggtcacgatccg
gtgatggaggccgtcctggtccgtggtgacgtcaacgcgccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggcgccgcaccgacgccccgattccaattctga

DBGET integrated database retrieval system