KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0935Help
Entry
xccb100_0935      CDS       T00759                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xca00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072984..1073595
Genome map
AA seq 203 aa AA seqDB search
MRGTLYIVAAPSGAGKSSIVNATLARDPKIALSISFTSRAPRPGERHAEHYHFVSAEEFQ
GMIEAGDFFEYALVHGDWKGTARQSVEPQLAAGHDVLLEIDWQGARQVRQKVPDAVSVFI
LPPSRQALDERMRKRGQDSEDVMAQRLAAAREEMLHFEEFDYVIINETFDTAVSEMCAIF
TASRLRRQAQQQRHAGLIQALLD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcaccctctatatcgttgcggccccttccggcgccggcaagagcagcatcgtc
aacgccaccctggcgcgtgaccccaagatcgccttgtcgatctccttcacctcgcgcgcg
ccgcgcccgggtgagcggcatgccgagcactaccatttcgtctctgccgaggaattccag
ggcatgatcgaagccggtgacttcttcgaatacgcgctggtgcatggcgactggaaaggc
accgcgcggcagtcggtggagccgcagctggcggccggccacgatgtgctgctggagatc
gattggcagggcgcacgccaggtgcggcagaaggtgccggacgcagtgagcgtgttcatc
ctgccgccgtcgcgccaggcgctggacgagcgcatgcgcaagcgcgggcaggacagcgag
gacgtgatggcgcaacgcctggccgccgctcgcgaagaaatgctgcatttcgaggaattc
gattacgtgatcatcaacgagaccttcgacaccgcggtgtcggagatgtgcgcgatcttc
accgccagcaggctgcgtcggcaggcccagcagcaacgccatgccgggctgatccaggcc
ttgctggactga

DBGET integrated database retrieval system