KEGG   Xanthomonas campestris pv. campestris B100: xccb100_0935Help
Entry
xccb100_0935      CDS       T00759                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    xccb100_0935 (gmk)
Enzymes [BR:xca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     xccb100_0935 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072984..1073595
Genome map
AA seq 203 aa AA seqDB search
MRGTLYIVAAPSGAGKSSIVNATLARDPKIALSISFTSRAPRPGERHAEHYHFVSAEEFQ
GMIEAGDFFEYALVHGDWKGTARQSVEPQLAAGHDVLLEIDWQGARQVRQKVPDAVSVFI
LPPSRQALDERMRKRGQDSEDVMAQRLAAAREEMLHFEEFDYVIINETFDTAVSEMCAIF
TASRLRRQAQQQRHAGLIQALLD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcaccctctatatcgttgcggccccttccggcgccggcaagagcagcatcgtc
aacgccaccctggcgcgtgaccccaagatcgccttgtcgatctccttcacctcgcgcgcg
ccgcgcccgggtgagcggcatgccgagcactaccatttcgtctctgccgaggaattccag
ggcatgatcgaagccggtgacttcttcgaatacgcgctggtgcatggcgactggaaaggc
accgcgcggcagtcggtggagccgcagctggcggccggccacgatgtgctgctggagatc
gattggcagggcgcacgccaggtgcggcagaaggtgccggacgcagtgagcgtgttcatc
ctgccgccgtcgcgccaggcgctggacgagcgcatgcgcaagcgcgggcaggacagcgag
gacgtgatggcgcaacgcctggccgccgctcgcgaagaaatgctgcatttcgaggaattc
gattacgtgatcatcaacgagaccttcgacaccgcggtgtcggagatgtgcgcgatcttc
accgccagcaggctgcgtcggcaggcccagcagcaacgccatgccgggctgatccaggcc
ttgctggactga

DBGET integrated database retrieval system