KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1262Help
Entry
xccb100_1262      CDS       T00759                                 

Gene name
nahA
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xca00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xca00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1464992..1467475)
Genome map
AA seq 827 aa AA seqDB search
MIATSGCDCMLSNTGPVPRTLSSRVLLSTRLPSRLLVCCVAVSALLGCGQREAGTAPAVA
SAGAPAAPAANTPLPLIPAPAQVTRGSGSFHIGAGTVISIVGGDADARRSAEYLADLLKR
TRGLSLEVRNETSASPGSIRLERSAQAPVAQKEGYSLDSDAKGIRIQARDGAGLFYGTVS
AWQLMTPDARKGDVEVPSVAIRDWPRFSWRGQHLDVARHFHDVATVKHVLDTMAVHKLNV
LHWHLTDDQGWRIEIKRYPKLTEVGAWRTPPGAGQHGTPERYGGFYTQEQISEVVAYAAR
LHITVLPELDMPGHAQAAVAAYPEEVGVPGVRTQVGVDWGVNPYLFNTSERSLTFITNVL
DEVLTLFPSTYIHIGGDEAVKDQWEASPAVRAQMRTLGVKDAHAMQGWFNEQLAQYLTQH
GRRMIGWDEILEGGVPASAAVMSWRGIEGAVTAAKQGHDVVLAPGDSLYLDNLQTTRSDE
PNGRLTTLPLSKVYAFNPVPAALSAEQSKHVLGAQGALWAEYIPSRWHIDHALFPRLAAV
AEVTWSPMAARDWKSFLARMPAQLQRYQALGIDYSDGAFAADIDLEGDVNAVLAGGPAKV
SLGNQSGAGSLHYTVDGSDPTPDAPRYTAPFAIQLPTTVKATVFTDDGIALAAPRSRTFD
RAALLSRDTQGLRHCVEQGALGLRLPLLPDLPGADTPVYNVDLFHACRLYPQARLDGVGA
IKVDAARLARNFGLAHEQSKVQKYPAKTRGGELEVRLGCEGELLARIPLPKGNALGEQFT
LESALPARPGTHDLCLRFTAPITGPLYAIGAVHLIETTAQAPPAATR
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
ctgattgccacatcgggatgtgattgcatgctctccaacaccggccctgttccacgcacg
ctgtcgtcgcgcgtgctgctgtccacacgattgccgtcgcgcctgcttgtctgctgcgtt
gcagtcagcgccctgcttggatgtggtcaacgcgaggccggcaccgcaccggccgttgcc
agtgccggcgcccccgcggcacctgccgccaacacaccgctgcccctgattccggccccg
gcgcaggtcacccgcggcagtggcagtttccacatcggtgccggcacggtgatttcgatc
gtcggtggcgatgccgatgcacgccgcagcgccgaatatctcgccgacctgctcaagcgc
acgcgcggcctgtcgctggaagtgcgcaacgaaaccagcgcatcgccgggcagcatccgc
ctggaacgcagcgcgcaggcaccggtagcgcagaaggaaggctatagcctggatagcgac
gcgaagggcatccgtatccaggcgcgtgatggcgccgggttgttctacggcaccgtgagc
gcatggcagctgatgaccccggatgcgcgcaagggcgatgtcgaggtaccgtcggtggcc
atccgcgactggccgcgtttcagctggcgcggccagcatctggatgtggcgcgccacttc
cacgacgtggcaacggtcaagcacgtgctcgacacgatggccgtgcacaagctcaacgtg
ctgcactggcatctcaccgatgaccagggctggcggatcgagatcaagcgctatcccaag
ctcaccgaggtgggtgcgtggcgcacgccgccgggcgcgggccagcacggcacaccggag
cgctatggcggcttctacacgcaggaacagatcagcgaagtggtggcctacgcggcgcgc
ctgcacatcaccgtgctgcccgagttggacatgcccgggcatgcgcaggcggccgttgcc
gcgtatcccgaagaagtgggcgtccccggtgtgcgcacccaggtgggtgtggactggggc
gtcaacccgtacctgttcaacaccagcgaacgcagcctgaccttcatcaccaatgtgctg
gatgaagtgctcacgctgttcccgtcgacctacatccacatcggcggcgatgaggcagtc
aaggaccaatgggaagcctcgccggccgtgcgcgcacagatgcgcacgctgggcgtcaag
gacgcacacgcgatgcaaggctggttcaacgagcaactggcgcagtacctcacccagcat
ggccggcgcatgatcggctgggacgaaatccttgaaggcggcgtgccggccagcgcggcc
gtgatgtcctggcgtggcatcgaaggcgcggtgaccgccgccaagcaaggccacgacgtg
gtgctggcaccaggcgattcgctgtatctggacaacctgcaaaccacgcgcagcgatgaa
cccaacggccgcctgaccacgctgccgctctcgaaggtctacgcgttcaacccggtgccg
gccgcgctcagtgccgagcagtccaagcatgtgctgggcgcacagggcgcgttgtgggcc
gaatacattccctcgcgctggcacatcgaccacgcgctgttcccgcgcctggcagcggtg
gccgaagtgacgtggtcgccgatggccgcgcgcgactggaagagtttcctggcgcgcatg
ccggcgcagctgcagcgttatcaggcgctgggcatcgattacagcgatggcgcgtttgcc
gccgacatcgacctggagggcgacgtcaacgcggtactggccggtggcccggccaaggtg
tcgctcggcaaccagagcggcgccggcagcctgcactacaccgtggatggcagcgacccc
acgccggatgcaccgcgctacacggcgccgttcgcgattcagctgcccaccaccgtcaag
gccaccgtcttcaccgacgatggcattgcactggccgccccacgcagccgcacctttgac
cgtgccgcgctgctgagccgcgacacccagggtctgcgccactgtgtcgagcaaggggcg
ctgggcctgcgcctgccgctgctgccggatctgccgggcgcggacacgccggtctacaac
gtggacctgttccatgcctgccgcctgtatccgcaggcgcggctggatggtgtgggcgcg
atcaaggtggacgccgcacgcctggcgcgcaacttcggcctggcgcacgagcagtccaag
gtgcagaagtacccggccaagacacgcggcggtgaactcgaagtgcgcctgggttgcgaa
ggcgagctgctcgcgcgcatcccgctgcccaagggcaacgcgctcggcgaacaattcacg
ctggaaagcgcgctgcctgcacgccccggcacgcacgatttgtgcctgcgcttcaccgcc
cccatcaccggcccgttgtatgccatcggcgccgtccatctgattgaaaccaccgcgcag
gcgccccccgccgccacgcgctga

DBGET integrated database retrieval system