KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1267Help
Entry
xccb100_1267      CDS       T00759                                 

Gene name
glk3
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_1267 (glk3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    xccb100_1267 (glk3)
   00052 Galactose metabolism
    xccb100_1267 (glk3)
   00500 Starch and sucrose metabolism
    xccb100_1267 (glk3)
   00520 Amino sugar and nucleotide sugar metabolism
    xccb100_1267 (glk3)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    xccb100_1267 (glk3)
   00524 Butirosin and neomycin biosynthesis
    xccb100_1267 (glk3)
Enzymes [BR:xca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     xccb100_1267 (glk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1474009..1475025
Genome map
AA seq 338 aa AA seqDB search
MSASSPMEAVAFPRPETFVAADVGGTHVRLALACESNDPRKPVTVLDYRKYRCADYPGLA
EIMAAFFAELSCAPVRRGVIASAGYALEDGRVITANLPWVLAPEQIRQQLGMQALHLVND
FEAVAYAANYMTGNQVMQLSGPAQGAPGPALVLGPGTGLGAALWIPNGGNSVVLPTEAGH
AALAAASDLEVALLQELRRTRTHVATEHFLSGPGLLTLYTALATLRDAPAVHATPAAVTA
AALAGDDVLAHEALQTFCGFMGSVVGDMMLLYGVRSGVYLAGGFLPQIADFIARSDFAAR
LLDKGPLRPALEQVPVRIVEHGQLGVIGAASWFLQHGR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaagcagcccaatggaagcggtggcatttccgcgccccgaaaccttcgttgcc
gccgatgtcggaggaacgcatgtgcgcctggcgctggcctgcgagagcaacgatccgcgc
aagccggtcaccgtgctggattaccgcaagtaccgctgcgctgattacccgggcctggcc
gagatcatggccgcgttctttgccgagctgtcctgcgcgccggtgcgccgtggcgtgatc
gccagcgccgggtatgcactggaagatggccgtgtgatcaccgccaatctgccgtgggtg
ctggcgccggagcagatccgccagcagctcggcatgcaggccttgcacctggtcaacgat
ttcgaagcggtcgcctacgcggccaattacatgaccggcaatcaggtcatgcagctgtcc
ggccccgcccagggcgctcctggcccggcattggtgctcggcccgggcactggcctgggc
gcggcgctgtggattcccaatggggggaactcggtggtgctgccgaccgaggccggccac
gccgcactggcggcagccagcgatctggaagtggccttgctgcaggagttgcgccgcacg
cgcacccatgtggcgaccgaacactttctctccggcccgggcttgctcacgctgtatacc
gcgctggccacgctgcgcgacgcgccggcggtgcacgccaccccggctgcggtcactgcc
gcagcactggcgggtgacgacgtgctggcgcacgaggcgctgcagacgttctgcggtttc
atgggcagcgtggtcggcgacatgatgctgttgtacggcgtgcgcagcggtgtgtatctg
gccggtggtttcctgccgcagattgccgacttcatcgcccgcagcgacttcgctgcccgc
ttgctcgacaagggcccgctgcgccctgcgctggagcaggtgccggtgcgcatcgtcgaa
catggccagcttggcgtgatcggtgccgccagctggttcctgcagcacggccgctaa

DBGET integrated database retrieval system