KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1271Help
Entry
xccb100_1271      CDS       T00759                                 

Definition
sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    xccb100_1271
Enzymes [BR:xca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     xccb100_1271
Transfer RNA biogenesis [BR:xca03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    xccb100_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478243..1479028
Genome map
AA seq 261 aa AA seqDB search
MELRETVIAIARQAGDAIMEVYAQDFAVEIKADASPLTQADLAANRVIVEGLRRVTPDVP
VLSEESVHVAWEERQYWTSYWLVDPLDGTREFVKRNGEFSVNIALIHMGAPVLGVVQAPV
DGRVWYAARGENAYRRDGDRDEMLHSRTPAAAPLRVAASRSHRDARTAAALERMGQIDVV
AQGSSLKFCRIAEGELDVYPRFGPTSEWDTAAGQCVLHAAGGALLAAGTGKPFRYNRRDT
LLNGDFIALGDPGLPWRDWLV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaattgcgcgagaccgtgatcgcgatcgcgcgccaggccggcgacgccatcatggag
gtgtacgcgcaggatttcgctgtcgagatcaaggccgacgccagcccgttgacccaggcc
gacctggccgccaaccgcgtcatcgtggaaggcttgcgccgggtcacgccggatgtgccg
gtgttgtcggaagagtctgtccacgtggcctgggaagaacgccagtactggaccagctat
tggctggtcgacccgctggatggcacgcgcgagttcgtcaagcgcaatggcgagttcagc
gtcaacatcgccctgatccacatgggcgcgccggtgctcggcgtggtgcaggcgccggtc
gatggacgggtctggtatgcggcgcgcggtgagaacgcctaccgccgcgatggcgaccgc
gacgaaatgctgcattcgcgcacgcccgctgctgccccgttacgggtcgccgccagccgc
tcgcatcgcgatgcacgcacggccgccgcgctggaacgcatgggccagatcgacgtggtg
gcgcagggctcctcattgaagttctgccgcatcgccgaaggcgagctggatgtgtacccg
cgcttcggtcccacctccgagtgggacaccgccgctggccagtgcgtgctgcatgccgcc
ggtggcgcgttgctcgcggccggcaccggcaagccgttccgctacaaccgccgcgacacc
ttgctcaatggcgacttcatcgccctgggcgaccccggcttgccgtggcgcgactggctg
gtgtaa

DBGET integrated database retrieval system