KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1338Help
Entry
xccb100_1338      CDS       T00759                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xca02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xca02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1555517..1556548
Genome map
AA seq 343 aa AA seqDB search
MVDNDLHRQQHRDVIVIGGSAGAGEALRRLLGALPAQTPAAILVVLHMSAHGHGIMRTVS
AGANGITVVEAADGMRIEPHTLYVAVADRHLMVADGRIVLGTGPRENMSRPSIDALFRSA
AVAFGPRTVGVLLSGMLNDGTAGLDAIHACGGTVLVQDPGEAVASDMPLSALQRVPADAV
RSSAELGGLIAELAQTAAGPAQVITDALRLEVAIARGALTTTDDTAQIATPVAMSCPACG
GVLSQISESCVLRFRCQVGHAYTGESLLSATEGSVDEALRIALRIIDERATLVARMADSN
TRAQPNTAAMYRHRADEYRGYADTLRKALLRKSPLAAAVEPSE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaacgacctgcaccgccagcaacaccgcgatgtcatcgtgatcggtggatcg
gctggggccggcgaggcgttgcggcgcctgttgggtgcgctgccagcgcagacgcctgcc
gccatcctggtggtgctgcacatgtcggcgcatggtcacggcatcatgcgcacggtcagt
gccggtgccaacggcattaccgtggtcgaggccgccgatggcatgcgcatcgaaccgcac
acgctctatgtcgcggtggccgaccgtcacctgatggtggccgacgggcgaatcgtgctg
ggcaccggcccgcgcgaaaacatgtcacggccgtcgatcgacgctttgttccgctcggca
gcggtggccttcgggcccagaacggtgggggtgctgctatcggggatgctcaacgatggc
accgcgggtcttgacgcgattcacgcctgcgggggcacggtgctggtgcaggatcctggc
gaggcggtggccagcgacatgccactgagtgcactgcagcgcgtgcccgccgatgccgtt
cgcagcagcgccgagttgggcggcctgattgcggaactggcgcagacagcggcagggccg
gcgcaggtgatcaccgatgccttgcgtctggaagtggcgatcgcacgcggtgcattgacc
acgaccgacgacaccgcgcagatcgccacgccggttgcaatgagttgcccggcctgtggc
ggcgtgctgtcgcagatatcggagagttgcgtgctgcggttccgctgccaggtcgggcat
gcctacacaggcgagagtctgctgtcggccaccgaagggtcggtggacgaggccctgcgc
attgccctgcgcatcatcgacgagcgggccaccttggtggcgcggatggccgattccaac
acccgtgcgcaaccgaataccgcagcgatgtaccgccatcgcgcggacgaataccgcggt
tatgcggacaccttgcgcaaggcgttgctgcgcaaatcgccgctcgctgcggcggtggaa
ccctcagagtga

DBGET integrated database retrieval system