KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1565Help
Entry
xccb100_1565      CDS       T00759                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    xccb100_1565
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    xccb100_1565
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    xccb100_1565
Enzymes [BR:xca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     xccb100_1565
Exosome [BR:xca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   xccb100_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1800641..1802461)
Genome map
AA seq 606 aa AA seqDB search
MHLIAGPPCPRGHDWNSGVSSVRRMHPGIMGIDSVTSSMPMRYRLPALAALTTLCVAACA
STAGSTTAAPASVKVDVPPVTHPAGETPQWWYRSGAARAAGNGAMAGKARNVILFLGDGM
SLTTVAAARILDGQRKGGPGEENLLSWEQFPATAFSKTYNTDSQTPDSAGTMTAITTGVK
SHMGAIGVSSGNRSDCADSLGKGLLSWLQLADSAGMATGVVTTTRLTHATPAATYAHSPE
RNWENDTDLPEAARTAGCQDIAQQLLSTARFGRGPQVVLGGGRSQFQTVQERDPEYDDKV
GLRLDGRDLVAEWKQSHPQGAYVWNQQQLQAAAGAPALLGLFEPDHMQFDHDRNRTPQGE
PSLTEMTRTAIQSLSRDPNGFVLMVEGGRIDHANHAGNAYRALDETVSLSDAVRTAVQTA
PPDTLIIVTADHSHTLNFVGYPVRGNPILGKVRGTGGEEGDRTQLATDLAGQPYTTLSYA
NGPGHTGATNAQPAGPKKYPHEPSSSEPAHGRPDLTHVDTEAPSYMQESLVPTKSESHGG
EDVGIWATGPGSAAFRGTLEENVIYHVIVQATPRLRARLCKAGTCDSAGVPVNLPAPATF
ERATQR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttatcgcagggccgccctgcccgcgaggccacgactggaacagcggcgtgtca
tcagtgcgacggatgcatcccggcataatgggcattgattcagtcacgagttcgatgccg
atgcgttaccgcctgcctgccctcgccgccctgaccacgctatgcgtggccgcctgcgct
tccactgccggatccaccaccgcggcgcccgcctcggtcaaggtggacgtgccaccggta
acgcatccggccggcgaaactccgcaatggtggtaccgctccggcgccgcacgtgcggcc
ggcaacggcgcgatggccggcaaggcacgcaacgtgatcctgttcctgggcgatggcatg
agcctgaccacggtggccgccgcacgcatcctggacggtcagcgcaagggcggcccgggc
gaagagaatttgctgtcgtgggagcaattccccgccaccgccttcagcaagacctacaac
accgattcgcagacccccgactcggccggcaccatgaccgcgatcaccaccggggtgaag
tcgcacatgggcgcgatcggggtcagcagcggcaaccgcagcgactgtgccgacagcctg
ggcaagggcctgctgagctggctgcaactggccgacagcgccggcatggccactggcgtc
gttaccaccacccgtctgacccacgccacgccggcggcgacctacgcgcattcaccggag
cgcaactgggaaaacgacaccgacctgcccgaggccgcccgcaccgccggctgccaggac
atcgcccagcaattgctctccactgcacgcttcgggcgtggcccgcaggtggtgctcggc
ggcggccgcagccagttccagaccgtgcaggagcgcgaccccgagtacgacgacaaggtc
ggcctgcgcctggacgggcgcgacctggtggccgagtggaagcagtcccacccgcaaggc
gcctacgtgtggaaccaacagcaattgcaggccgccgctggcgcaccggcgctgctgggc
ctgttcgagcccgatcacatgcagttcgaccatgaccgcaaccgcacgccgcaaggcgag
cccagcctgaccgagatgacccgcaccgcgatccagtcgctgtcgcgcgacccgaacggt
tttgtgctgatggtcgaaggcggccgtatcgatcacgccaaccacgccggcaatgcctac
cgcgcgctggatgaaacggtctcgctgtcggatgcggtgcgcaccgccgtgcagacggcg
ccgccggacacgctgatcatcgtcaccgccgaccattcgcacacgctcaacttcgtgggc
tacccggtgcgtggcaacccgatcctgggcaaggtgcgcggcaccggcggcgaagaaggc
gaccgcacccagctggccaccgatctggccggccagccctacaccaccctcagctacgcc
aatggccccggccataccggcgcgaccaacgcacagccggccgggccgaaaaagtatccg
cacgagcccagcagcagcgagccggcccacggccgccccgacctcacccatgttgatacc
gaggcgcccagctacatgcaggaatcgctggtaccgaccaagtccgaaagccacggcggc
gaagacgtcggcatctgggccaccggcccgggcagcgcggcgttccgcggcacgctggaa
gaaaacgtgatctaccacgtcatcgtccaggccaccccgcgtctacgtgcgcgcctgtgc
aaggccggcacctgcgacagcgccggggtgccggtaaacctgcccgcacccgccaccttc
gagcgcgcgacccagcgctga

DBGET integrated database retrieval system