KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1621Help
Entry
xccb100_1621      CDS       T00759                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    xccb100_1621 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    xccb100_1621 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    xccb100_1621 (trpA)
Enzymes [BR:xca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     xccb100_1621 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1867183..1868001
Genome map
AA seq 272 aa AA seqDB search
MSRAPDRIAACFDALRHSGRKALIPFITAGDPSLEATVPVMHALVRAGANIIELGVPFSD
PMADGPTIQRSSERALGRGAGLAYVIEAVQEFRREDATTPVVLMGYLNPIEIHGTRRFAE
TAVAAGIDGVLLVDLPPEEADETRAIFTEVGLALIALASPTTGEARLDMLCSTAQGYLYY
VSFSGVTGAADRLDTHAASDRLRQLRARAGAPVVAGFGIKDAASAAAMAVDADGVVVGSA
LVAALADASDVRSARERAEDFLQPLRQALDAG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcgcccgaccgtatcgctgcgtgcttcgacgcgctgcgtcactccggccgc
aaggcgctgattcccttcatcaccgccggcgacccctcattggaagccaccgtgccggtg
atgcatgccctggtgcgcgctggtgcgaacatcatcgagctcggcgtgccgttctccgac
ccgatggccgacggccccaccatccagcgcagctccgagcgcgcgctgggccgcggtgcc
ggtctggcctatgtgatcgaagccgtgcaggaattccggcgcgaggacgccaccaccccg
gtggtgctgatgggctacctcaacccgatcgaaatccacggcaccaggcgctttgccgaa
accgcggtggccgccggcatcgatggcgtgctgctggtcgacctgccgcccgaggaggcc
gacgagacccgcgccatcttcaccgaggtcggtctggcgctgatcgccttggcgtcgccc
accaccggcgaggcccggctggacatgctgtgcagcactgcgcagggctatttgtattac
gtcagcttctctggcgtgactggcgcggccgaccggctggatacgcacgccgccagcgac
cgcctgcgccagctgcgcgcccgtgccggcgcaccggtggtggccggcttcggcatcaag
gacgccgccagtgctgccgcgatggcggtggatgcggacggcgtggtcgtcggcagtgcg
ctggtggcggccctggccgacgcatcggacgtacgcagtgcgcgtgaacgggccgaagac
ttcctgcagccgctgcggcaggcgctggacgccggctga

DBGET integrated database retrieval system