KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1631Help
Entry
xccb100_1631      CDS       T00759                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_1631 (tpiA)
   01230 Biosynthesis of amino acids
    xccb100_1631 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    xccb100_1631 (tpiA)
   00051 Fructose and mannose metabolism
    xccb100_1631 (tpiA)
   00562 Inositol phosphate metabolism
    xccb100_1631 (tpiA)
Enzymes [BR:xca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     xccb100_1631 (tpiA)
Exosome [BR:xca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   xccb100_1631 (tpiA)
  Exosomal proteins of bladder cancer cells
   xccb100_1631 (tpiA)
  Exosomal proteins of melanoma cells
   xccb100_1631 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1878463..1879263
Genome map
AA seq 266 aa AA seqDB search
MGYSHACLQLRNLHLMRRKIVAGNWKLHGTRAFATELVAQVAAHMPLAGVDVVILPPLPY
LGDLIEDFEAHHLAFGAQDVSSNEKGAYTGEVSASMLVDVCAEYGLVGHSERRQYHQESS
ELVARKFAAAMHAGLIPVLCVGESLEQREAGQTEAILRAQLEPVLSLVGSTGFARAVVAY
EPIWAIGAGRTATPDQAQAVHAFIRGEVAKADARIADSLPILYGGSVKPDNASELFSQPD
VDGGLVGGASLVAEDFLAIARAAAAC
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggctattctcacgcctgtcttcaactcaggaacctgcacctgatgcgtcgaaagatc
gttgctggaaattggaagctgcatggcacgcgtgccttcgccaccgaactggtggcgcag
gtggccgcgcacatgcccctggcgggtgtcgatgtcgtcatcctgccgcccttgccgtat
ctcggtgatctgatcgaggacttcgaggcccaccacctggcattcggtgcacaggacgtc
agtagcaacgagaagggcgcctacaccggtgaagtgtccgcctcgatgctggtggatgtc
tgtgccgaatacggcctggtcgggcattcggagcgccgtcagtatcaccaggaaagcagc
gagctggtcgcgcgcaagtttgccgccgcaatgcatgccgggttgatcccggtgctgtgc
gttggcgaatcgctggaacagcgcgaggccggtcagactgaggcaatcctacgtgcccag
ttggagccggtcctgagcctggtcggcagcaccggattcgcccgcgccgtagtggcctac
gagccgatctgggccatcggggccgggcgcaccgccacgccggaccaggcccaggccgtg
cacgccttcattcgtggcgaagtcgcgaaggcggatgctagaattgccgattcactgccc
atcctgtacggggggagtgtcaagcccgacaacgccagcgagctgttttcccagcccgac
gtcgacggtgggctggtcggcggcgcatcactggttgccgaagacttcctggccatcgcg
cgtgcggcggccgcttgttaa

DBGET integrated database retrieval system