KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1785Help
Entry
xccb100_1785      CDS       T00759                                 

Definition
cellulose 1,4-beta-cellobiosidase (EC:3.2.1.91)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    xccb100_1785
Enzymes [BR:xca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     xccb100_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2073678..2075438
Genome map
AA seq 586 aa AA seqDB search
MTIFQTLLTAMVIASPIAACAADTTGTAGTTPAAGATIHVNQLGYLPGSAKLAVVGLPAS
AAAGPDRFTVEDAKGARVLEGSLSPAASWAPAGQQARVADFSALRTPGTYRLKIAGMPAS
DAFPIAASAYQPVVDASLKAFYYNRASTELPAQFAGRYARAAGHPDTEVRIHPSAASATR
PANSVISAPKGWYDAGDYNKYIVNSGISTYTVLAAYEHYPALFKAQALTIPNDAPGVPGI
LQEVWWNLEWMLAMQDPADGGVYHKLTDKQFDGLVMPDQAKQQRYVVMKATAATLDFAAV
MAAASRVYAPFDKQYPGASARMLKAARSAWAWAQQHPNVIYRQPDDVRTGGYDDATVDDE
FAWAAAELYVSTREDAFYDAMLARNVHASVPGWSNVGGLAWMSLAAHRDQLTPHADRARI
EGEISGLAQRLGDQWQASPWRLAMADNDFVWGSNAVVLNQAMMLLQGYRVTQQRRYLDAA
QSQLDYILGRNPLGLSFVTGVGQRTPMHIHHRPSEADGIDAPVPGWLAGGPQPGQQDAKD
CKVAYPSKLAALSYLDNTCSYATNEVAINWNAPLVYVSAAIEASTR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttccagaccctgctcaccgccatggtgatcgcatcgcccatcgccgcctgt
gcggcggacacgaccggcactgccggcaccacgccggccgctggcgccaccatccacgtc
aatcaactcggctatctgccgggctcggccaagctggcggtggtcggcttgccggcgtcc
gctgcggccggtccagaccgcttcacggtggaggatgccaagggcgctcgcgtgctggag
ggcagcttgtcgccggcggccagttgggcaccggcggggcaacaggcacgcgtggccgac
ttttccgcactgcgcacgccgggcacgtatcggttgaagatcgccggcatgccggcctcg
gatgcattcccgattgcagcgagtgcctaccagccggtcgtggatgcctcgctgaaggcg
ttctactacaaccgtgccagtaccgagttgccggcgcagtttgccgggcgctacgcgcgc
gcggccgggcatccggacaccgaggtgcgcatccatccgtcggcggcgtctgccacgcgc
ccggccaacagcgtgatcagcgcgcccaaggggtggtacgacgcgggcgactacaacaag
tacatcgtcaattccggcatcagcacctacaccgtgctggccgcgtatgagcactacccg
gcgctgttcaaggcgcaggcactcaccattcccaacgatgcgcctggcgtgcccggcatc
ctgcaggaagtgtggtggaatctggaatggatgctggcgatgcaggacccggccgatggc
ggggtgtaccacaagctcaccgacaagcagttcgatgggctggtgatgccggaccaggcc
aagcagcagcgctatgtcgtgatgaaggccaccgccgccacgctggatttcgccgcggtg
atggcggcggccagccgcgtgtatgcgccgttcgacaagcagtatccaggcgcgtcggcg
cgcatgttgaaggcggcgcgtagtgcctgggcgtgggcgcaacaacacccgaacgtgatc
tatcgccagcctgacgacgtgcgtaccggcggctacgacgacgccaccgtagatgacgaa
tttgcctgggcagcagcggagctctatgtgagcacgcgcgaggacgcgttctacgacgcc
atgctggcgcgcaacgtacatgccagcgtgccggggtggagcaacgtgggtggattggcc
tggatgtcgttggccgcccaccgtgaccagctcacgccgcatgccgaccgcgcacgtatc
gaaggcgaaatcagcgggctggcgcagcgcctgggcgaccagtggcaggcatcgccgtgg
cgtttggccatggccgataatgactttgtctggggcagcaatgcggtggtactcaatcag
gccatgatgctgctgcagggctaccgggtgacgcagcaacgtcgttatctggatgcggcg
caatcgcagctggactacatcctggggcgcaatccgctggggctgtcgttcgtcaccggg
gtcgggcagcgcacgccaatgcatatccaccatcgcccatccgaagccgacggcatcgat
gcgcccgtgccgggctggctggccggtggcccgcagccgggccagcaggacgcgaaagac
tgcaaggtggcgtatccgtccaagctggccgcgctgtcgtatctggacaacacctgcagc
tacgcgacaaacgaggtagcgatcaactggaatgcgccgctggtgtatgtaagtgctgcg
atcgaggcgtcgacccgctga

DBGET integrated database retrieval system