KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1878Help
Entry
xccb100_1878      CDS       T00759                                 

Definition
hypothetical protein
Orthology
K06925  
tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
Transfer RNA biogenesis [BR:xca03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    xccb100_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2197748..2198248
Genome map
AA seq 166 aa AA seqDB search
MTTLHAFLADVDATEQVGQALAATRPATAVVQLHGDLGAGKSTLARALLRALGVTGPIRS
PTYTLVERYPLTAGGEAWHLDLYRIGHAGELDFLGLDEGSATLWLVEWPERGAGALPAAD
LEVELAVAGEGRALTLRGASPSGQAWVNELAARDELRALFAAEQEE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctgcacgcctttctggccgacgtcgatgccaccgagcaggtcgggcaggcc
ctggcggccacccggcccgccaccgccgtggtgcagttgcacggcgacctgggcgccggc
aaatccaccctggcgcgtgcgttgttgcgtgcgctcggcgtcaccggccccattcgcagc
cccacctacacgcttgtggaacggtatccactgactgccggtggcgaagcctggcatctg
gatctgtaccgcatcggccacgcgggggagctggattttctcggactggacgagggcagt
gccaccctgtggctggtcgaatggccggagcgcggggctggcgctttgccggcggcggat
ctggaggtcgaattggcagtggccggggagggacgcgcgctgaccctgcgcggcgcgagc
ccaagcgggcaggcatgggtgaacgagctggcagcgcgggacgagttgcgggcgcttttt
gccgccgaacaagaggaatga

DBGET integrated database retrieval system