KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1940Help
Entry
xccb100_1940      CDS       T00759                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    xccb100_1940
  Amino acid metabolism
   00330 Arginine and proline metabolism
    xccb100_1940
Enzymes [BR:xca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     xccb100_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2262924..2264078
Genome map
AA seq 384 aa AA seqDB search
MTQPVVATSLFTEQVLPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREV
VIVSSGAVAAGRAILPKAAEAGAAIAARQALAALGQAQLIALWQRFFERPVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDEVAELSAEVLAMAGGSGSSVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSSEVVRGLAQDRLRGTRIHPARTRIAARKYWLRHAPVEPGAILIDAGAAA
ALAGKGASLLPGGVATAQGDFRRGDMVEIRLRDADGERCLARGVSQYSAVDIRRIAGRHS
REIETVLGYSYGENVVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacccagccggtcgtcgcgacctcgctgtttaccgagcaggtgctgccgccgtggcgg
cgcgcagtgctcaaggtcggcagcagcctgctggcggccgatggcggcggcctgtcgccg
cggtttgcgctgggcctggcgcagtttgtatcggccaatctggcggcggggcgcgaagtg
gtgatcgtctcgtccggcgcggtggcggccgggcgcgccatcctgcccaaggcagccgaa
gctggcgccgccatcgctgcgcgccaggcactggccgcgctgggccaggcgcagttgatc
gcgttgtggcagcgctttttcgagcgcccggtggcgcaggtgctgctcacccacgacgac
ctgcgcaaccgccgccgctacctcaatgcgcgcgccacgctgggcgaactgttgcggctg
ggcgcattgccggtgatcaacgagaacgacaccgtgtcggtggatgagctcaagctcggc
gacaacgacaacctggccgcgatcgtggccgcgctggtcgatgccgatgccttgttcatc
gccaccgatatcgatggcctgtacagcgccgacccgcgcagcaacccgctggcacgcccg
ctcgacgaggtggccgaactcagcgccgaggtgctggcgatggccggcggcagcggcagc
agcgtgggcaccggcggcatgcgcaccaagctggaagccgccgcaaaagccggtgctgcc
ggcatcgaaacctatctgttcaacggccgcagcagcgaggtggtgcgcgggcttgcgcag
gatcgcctgcgcggcacgcgcatccaccctgcacgcacgcgcattgccgcccgcaaatac
tggctgcgccacgcaccggtggaaccgggcgcgatcctgatcgatgccggtgccgcggcg
gcgctggccggcaagggcgcatcactattgccgggcggtgtggccactgcacaaggcgac
ttccggcgcggcgacatggtggagatccgcctgcgcgacgccgatggcgaacgctgcctg
gcacgcggcgtcagccagtattcggcagtggatatccgccgcatcgccggccgtcattcg
cgcgagatcgaaaccgtgctcggttacagctatggcgagaatgtggtgcatcgcgatgat
ctggtgctgttgtag

DBGET integrated database retrieval system