KEGG   Xanthomonas campestris pv. campestris B100: xccb100_1992Help
Entry
xccb100_1992      CDS       T00759                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    xccb100_1992 (galU)
   00052 Galactose metabolism
    xccb100_1992 (galU)
   00500 Starch and sucrose metabolism
    xccb100_1992 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    xccb100_1992 (galU)
Enzymes [BR:xca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     xccb100_1992 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2320593..2321486
Genome map
AA seq 297 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMADVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAEL
LKQEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGAPAKEIIRSALAAADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacggtgccgaaggaaatgctgccgatcatcgataaaccgcttatccag
tacgccgtggacgaagccatccaggccggttgcgatacgctgatcttcgtcaccaatcgc
tacaagcactcgatcgccgactacttcgacaaggcctatgagctggagcagaagctcgag
cgcgcaggcaagctcgagcaattggagctggtgcgccatgcactgcccgaaggcgtccgc
gccatttttgtgacgcaggccgaagcgctcggcctgggccatgcggtgctgtgtgccaag
gccgtggtcggtgacgaaccgttcgcagtgctgctgcccgacgacctgatgtggaaccgc
ggcgatgcggcgctgacccagatggccgatgtggcagaagcctccggcggcagcgtgatc
gccgtggaagatgtgccgcacgacaagacggccagttatggcatcgtgtccaccgatgcg
ttcgacggccgcaagggccgcatcaatgccatcgtcgaaaagcccaagccggaagtggcg
ccgagcaatctggcggtcgtcggtcgttacgtgctgagcccgaagatcttcgagtacctg
gagtccacgggcgccggtgcaggtggcgagatccagctcaccgatgcgatcgccgaactg
ctcaagcaggaacaggtcgatgcgttccgtttcgagggccgtcgcttcgactgcggcgcg
cacatcggtttgatcgaggccacggtgcactttgcgctcgagcacgagaagcatggcgca
ccggcgaaggaaatcattcgcagcgccttggccgcggccgacgcacgcggctga

DBGET integrated database retrieval system