KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2019Help
Entry
xccb100_2019      CDS       T00759                                 

Definition
short-chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    xccb100_2019
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    xccb100_2019
Enzymes [BR:xca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     xccb100_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2351175..2351933)
Genome map
AA seq 252 aa AA seqDB search
MRSILITGAGSGIGAGLATVLAADGHHLLVSDADLAAAEQTTQQVRAAGGSAEALVLDVT
DEHSIAQALAAAARAPEVLVNNAGLQHVAPLEEFPMQRWALLVDVMLTGAARLSRAVLPG
MRAGGYGRIVNIGSIHSLVASPYKSAYVAAKHGLIGLSKVLALETADCDITANTLCPSYV
RTPLVERQIADQARTRGIAEDAVIREVMLKPMPKGAFIEYDELAGTVAFLMSHAARNLTG
QAIAIDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcctgatcaccggtgccggcagcggcatcggcgccggcctggccaccgtt
cttgccgccgacggccaccacctgctggtgagcgacgccgacctggccgcggccgagcag
accacccagcaggtgcgtgcggccggcggatcggccgaggccctggtactggacgtcacc
gacgagcacagcattgcccaggcactggcggccgccgcgcgcgcgcccgaggtgttggtc
aacaacgccggcctgcagcacgttgcgccgctggaggagttcccgatgcagcgctgggcg
ctgctggtggacgtgatgctgaccggtgccgcacgtctcagccgcgcggtgctgccgggc
atgcgtgcgggcggctacgggcgcatcgtcaacatcggcagcatccattcgctggtggcc
agcccttacaagagcgcctacgtggctgccaagcatgggctgatcgggctgtccaaggtg
ctcgcgctggaaaccgccgactgcgacatcaccgccaacacgctgtgccccagctatgtg
cgcacgccgctggtggagcggcagatcgccgaccaggcacgcacgcgcggcattgccgaa
gacgcggtgatccgcgaggtgatgctcaagccgatgcccaaaggcgccttcatcgagtac
gacgaactggccggcaccgtggccttcctgatgtcgcacgcggcgcgtaatctcaccggc
caggccatcgccatcgacggtggctggaccgcgcaatga

DBGET integrated database retrieval system