KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2047Help
Entry
xccb100_2047      CDS       T00759                                 

Gene name
sdhD
Definition
succinate dehydrogenase (ubiquinone) membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:xca01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:xca00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:xca00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:xca00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2385153..2385539
Genome map
AA seq 128 aa AA seqDB search
MSRYRTPLKNVRGLGAAKTGTEHFVVQRLTATALVPLSIWFLILVLSLIGADHTAASAAV
AKPWNAILLVGFLIASFWHAQLGMQVVLEDYVHNSLLALAAQTLVRFVAVLGAIVSVFAV
ARIALGIA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctatagaaccccgttgaagaacgtgcgcggcctgggcgccgccaagaccggc
accgagcatttcgtggtgcagcgtctgaccgccaccgcgctggtgccgctgtcgatctgg
ttcctgatcttagtgttgagcctgatcggtgccgaccacacagcggcgagcgccgcggtt
gccaagccgtggaacgcgatcctgctggtgggcttcctcatcgcctcgttctggcatgcg
cagctcggcatgcaggtggtgctggaggattacgtgcacaactcgctgctcgcccttgcg
gcgcagaccctcgtgcgctttgtcgccgttctcggtgccatcgtcagcgtgtttgccgtg
gcgcgtatcgcgctaggcatcgcctga

DBGET integrated database retrieval system