KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2090Help
Entry
xccb100_2090      CDS       T00759                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    xccb100_2090
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    xccb100_2090
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    xccb100_2090
Enzymes [BR:xca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     xccb100_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2424353..2425660
Genome map
AA seq 435 aa AA seqDB search
MMFISTRGAAPAVSLSQAIAAGLAPDGGLYVPQTLPPARTLQAGATLADTATTLLQPFFE
GDALAGELAAICAEAFDFPAPLVPLATPGDYALELFHGPTAAFKDFGARFLAACLTRLRR
AEDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALR
VAGTFDDCQAMVKQALNDGELQTQVPLSSANSISLGRLLPQMSYYAHAALQHHARSAAAL
NLVVPTGNLGNGLAAILARTLGVPLGQIALASNANHVLPDYFAGDDYAPQPSVATVANAM
DVGAPSNFERLRWLYDGDDAALREAFRALSVDDTAIRHTVQQRFARYGEVHCPHTATAVH
VLEQLRAEGAEGGTGDWAVAATAHPAKFEAVVEPLIGRAVEIPPALAALLLRPAHAEPLA
PDYQAFRQRLLADAP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcatctctacccgtggcgccgcacctgccgtgagcctgagccaggcgatcgcc
gccggcctggccccggacggcggcctgtacgtgccgcagaccctgccgccggcgcgcacc
ctgcaggccggcgcaacgctggccgacacggccaccacactgctgcagccgttcttcgaa
ggtgacgcgctggcaggcgagctggcggccatctgcgccgaagcgttcgatttcccggcg
ccgctggtgccgctggccacgccgggcgactacgcgctggagctgttccatggccccacc
gcggccttcaaggattttggtgcgcggttcctggcagcttgcctgacccggctgcggcgc
gcggaagaccgcccgctgaccattctggtggccacctccggcgataccggcgcggccgtg
gcagcggcgttccatcggcagcccggcctgcgggtggtggtgttgtacccggatggccgc
gtgtcgccacggcaggcgcatcagctgggctgcttcggcgacaacatccaggcattgcgt
gtggccggcaccttcgacgactgccaggccatggtcaagcaggccttgaacgatggcgag
ctgcagacgcaggtgccgctgagttcggccaatagcatcagcctggggcggctgctgccg
caaatgagctactacgcgcacgcagcgctgcagcaccacgctcgctccgcggccgcattg
aacctggtggtgcccaccggcaacctgggcaacggcctggcggcgatcctggcacgcacg
ctcggcgtgccgctgggccagatcgcgctggcgtccaatgccaaccatgtattgcccgac
tacttcgccggcgacgactacgccccgcaacccagcgtggctaccgtggccaacgcgatg
gacgtgggcgcgcccagcaatttcgaacgcctgcgttggctgtatgacggcgacgatgcg
gcgctgcgcgaggcgttccgtgcgctctcggtggatgacacggcgatccgccacaccgtg
cagcaacgcttcgcacgctacggcgaagtgcattgcccgcataccgccaccgccgtgcac
gtactggagcaattgcgtgcggaaggggccgagggcggcactggcgactgggcggtggcg
gccacggcgcacccggcaaagttcgaggcggtggtggagccactgatcggccgcgcggtg
gagatcccgccggcgctggcggccttgttgctgcgcccggcgcatgccgaaccgctggca
ccggactatcaagcgttccggcagcgtctgctcgcggatgcgccctga

DBGET integrated database retrieval system