KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2106Help
Entry
xccb100_2106      CDS       T00759                                 

Definition
Acireductone dioxygenase family protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:xca00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2440878..2441444)
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFADSNPTTPHFDSRDGEQIATELRKIGVTFERWHASQPVEPGASPEQVMAAYRA
DIDRISAERGFKTVDVVSIAPDNPKREEMRAKFLDEHFHKEDEVRFFVAGSGLFTLHVDA
QVYEIECVKDDLIAVPDSTLHWFDMGPEPHFVAIRFFTEPDGWVGHFTGTEIAKQFPRYA
PEKPPKAS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactgcgtatttttgccgattccaacccgaccaccccgcacttcgacagccgc
gacggtgagcagatcgccaccgagctgcgcaagattggtgtcaccttcgagcgctggcac
gccagccagccggtcgaaccgggtgcatcgcccgaacaggtgatggccgcctaccgcgcc
gacatcgaccgcatcagcgccgagcgcggcttcaagaccgtggacgtggtgagcatcgcg
ccagacaaccccaagcgcgaagaaatgcgtgccaagttcctggatgagcacttccacaag
gaagacgaggtgcgcttcttcgtggccggctccgggttgttcacgctgcacgtggacgcg
caggtctacgagatcgaatgcgtcaaagatgatctgattgcggtgccggacagcacgttg
cattggttcgacatgggcccggagccgcacttcgtggcaatccgtttcttcaccgagccg
gacggttgggtcggccacttcaccggcaccgaaatcgccaaacaattcccccgctacgcc
cccgagaaacctccaaaggccagctga

DBGET integrated database retrieval system