KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2313Help
Entry
xccb100_2313      CDS       T00759                                 

Definition
NDP-hexulose epimerase (EC:5.1.3.-)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    xccb100_2313
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    xccb100_2313
Enzymes [BR:xca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     xccb100_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2686886..2687467)
Genome map
AA seq 193 aa AA seqDB search
MIFRPTPLSGAFIIEPEPRGDARGWFARVFCTQEMAQAGLVDQFVQVNNSFNAEAGTLRG
MHYQLPPAPEVKIVRCIRGALWDAIVDLRPDSPTYLQWYGVELSADNRLALYVPRGFAHG
FITLQAQTEALYFASAMYTPAAERGLRWDDARIGIRWPCTPALLSDKDAAWPEFNEQVHG
VTQLTGLTQQERA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcttccgccccacgccgttgtctggcgccttcatcattgaacccgaaccgcgtggc
gatgcgcgtggatggtttgcgcgggtgttctgtacccaggaaatggcgcaggccgggctg
gtagaccagttcgtacaggtcaacaactctttcaacgcagaggctggcaccttgcgcggc
atgcactatcagctgccgcccgcgccggaggtcaagatcgtgcgctgcatccgcggcgcg
ctgtgggatgccatcgtcgacctgcgcccggattcgcccacctacctgcagtggtacggg
gtcgaactcagtgccgacaaccgcctggcactgtatgtgccgcgcgggtttgcgcatggc
ttcatcacgctgcaggcgcagacagaagcgctgtatttcgccagtgcgatgtatacgccg
gctgccgaacgcggcctgcgctgggacgatgcgcgcattggcatccgctggccgtgcacg
cccgcattgctgtccgacaaggacgccgcctggccggagttcaatgagcaggtgcatggc
gtgacccaactgaccgggctgactcaacaggagcgcgcatga

DBGET integrated database retrieval system