KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2496Help
Entry
xccb100_2496      CDS       T00759                                 

Gene name
folK2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    xccb100_2496 (folK2)
Enzymes [BR:xca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     xccb100_2496 (folK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2892280..2892765)
Genome map
AA seq 161 aa AA seqDB search
MLTAFVGLGANLGQAEATVRAAIVALGTLPQSSVTAASRLYRTPAWGREDQPDFINAVAA
VRTALAPLALLDGLLAIEQAFGRDRRDGERWGPRTLDLDVLLYAEQVIDLPRLQVPHPHL
RARAFALVPLAELAPEAIIPGHGTVRHALQGVDGCGLEPIG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccgcctttgtcggcctgggcgccaacctgggccaggccgaggccaccgtgcgc
gcggccatcgtcgcgctgggcacgctgccgcagtcgtcggtgaccgccgcttcgcggctg
taccgcacgccggcctggggccgtgaggaccagccggacttcatcaatgccgtggccgcc
gtgcgcactgcgctggcgccgctggcgctgctggacgggctgctggcgatcgagcaggca
ttcggccgcgaccgtcgcgacggcgagcgctggggcccgcgcaccctggatctggatgtg
ttgctgtatgccgagcaggtgatcgacctgccgcgtttgcaggtgccgcacccgcatctg
cgtgcccgtgcgtttgcgctggtgccgctggccgagctcgcccccgaggcgatcattcca
gggcatggaacagtgcgacacgccctgcagggcgtcgatggctgtgggctggagccgatt
gggtag

DBGET integrated database retrieval system