KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2545Help
Entry
xccb100_2545      CDS       T00759                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    xccb100_2545
Enzymes [BR:xca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     xccb100_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2955854..2956762)
Genome map
AA seq 302 aa AA seqDB search
MPMFDTTPQLNCAGRLLRLDGPQVMGIVNVTPDSFSDGGQHTTVDAAVAHGLRLVAEGAA
VLDVGGESTRPGANAVSVEEELQRVIPVIQALSAQTAVPISVDTYKPEVMRAAVGAGAGM
INDVHALRSPGALEAAAELAVPVVLMHARSAPHAMQAEPHYDDVVAEVHRFLAERIFAAE
MAGIDKRRLILDPGFGFDKSTAHNLTVLAQLQRLQEFGLPVLAGFSRKRTIGELTGRQVA
ADRVHGSVAAHLIAAQQGAQLLRVHDVAATVDALKVWRAVAAIPTPRAAAPAAPTIRWPD
ED
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatgttcgacaccacaccgcaattgaactgcgccggccgcctcctgcgcctggat
ggcccgcaggtgatgggcatcgtcaatgtcacgccggactcgttctccgatggcggtcag
cacacgacggtggacgcggcggtggcccatgggctgcgactggtcgcagaaggtgcggcg
gtgctggatgtgggcggtgaatccacccggcctggcgccaatgcggtatcggtggaagag
gagctgcagcgggtgatcccggtgatccaggccctgagcgcgcagaccgctgtgccgatc
agcgtggacacctacaagcccgaggtcatgcgcgccgcagtcggcgcgggcgcgggcatg
atcaacgatgtacacgcgttgcggtcgccgggcgcgctggaggcggctgcggaactcgcg
gtgccggtggtgctgatgcatgcgcgcagcgcaccgcatgcgatgcaggccgagccgcat
tacgacgatgtggtggccgaggtgcatcgctttctggccgagcgtatttttgctgcggaa
atggccggcatcgacaagcgtcggctgatcctcgaccccggattcggcttcgacaagagc
accgcgcacaacctcaccgtgctggcgcaactgcagcggctgcaagaatttggcctgccg
gtgctggcgggattctcgcgcaagcgcacgatcggtgaattgaccggtcgccaggttgcg
gccgaccgcgtgcatggctcggtggccgcgcatctgatcgccgcccagcagggcgcgcaa
ctgctgcgcgtgcatgacgtggcggcgaccgtggatgcgttgaaggtatggcgtgcggtg
gctgcaattcccaccccgcgcgcggcagcacctgcggcgccgacgattcgctggccggac
gaggactga

DBGET integrated database retrieval system