KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2545Help
Entry
xccb100_2545      CDS       T00759                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2955854..2956762)
Genome map
AA seq 302 aa AA seqDB search
MPMFDTTPQLNCAGRLLRLDGPQVMGIVNVTPDSFSDGGQHTTVDAAVAHGLRLVAEGAA
VLDVGGESTRPGANAVSVEEELQRVIPVIQALSAQTAVPISVDTYKPEVMRAAVGAGAGM
INDVHALRSPGALEAAAELAVPVVLMHARSAPHAMQAEPHYDDVVAEVHRFLAERIFAAE
MAGIDKRRLILDPGFGFDKSTAHNLTVLAQLQRLQEFGLPVLAGFSRKRTIGELTGRQVA
ADRVHGSVAAHLIAAQQGAQLLRVHDVAATVDALKVWRAVAAIPTPRAAAPAAPTIRWPD
ED
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatgttcgacaccacaccgcaattgaactgcgccggccgcctcctgcgcctggat
ggcccgcaggtgatgggcatcgtcaatgtcacgccggactcgttctccgatggcggtcag
cacacgacggtggacgcggcggtggcccatgggctgcgactggtcgcagaaggtgcggcg
gtgctggatgtgggcggtgaatccacccggcctggcgccaatgcggtatcggtggaagag
gagctgcagcgggtgatcccggtgatccaggccctgagcgcgcagaccgctgtgccgatc
agcgtggacacctacaagcccgaggtcatgcgcgccgcagtcggcgcgggcgcgggcatg
atcaacgatgtacacgcgttgcggtcgccgggcgcgctggaggcggctgcggaactcgcg
gtgccggtggtgctgatgcatgcgcgcagcgcaccgcatgcgatgcaggccgagccgcat
tacgacgatgtggtggccgaggtgcatcgctttctggccgagcgtatttttgctgcggaa
atggccggcatcgacaagcgtcggctgatcctcgaccccggattcggcttcgacaagagc
accgcgcacaacctcaccgtgctggcgcaactgcagcggctgcaagaatttggcctgccg
gtgctggcgggattctcgcgcaagcgcacgatcggtgaattgaccggtcgccaggttgcg
gccgaccgcgtgcatggctcggtggccgcgcatctgatcgccgcccagcagggcgcgcaa
ctgctgcgcgtgcatgacgtggcggcgaccgtggatgcgttgaaggtatggcgtgcggtg
gctgcaattcccaccccgcgcgcggcagcacctgcggcgccgacgattcgctggccggac
gaggactga

DBGET integrated database retrieval system