KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2592Help
Entry
xccb100_2592      CDS       T00759                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xca00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xca02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3005033..3005428
Genome map
AA seq 131 aa AA seqDB search
MHPFHKTLLCAPLAGLLLAGATLAPPARAADGAGKDTFMAECAECHSATQGKNKKGPSMF
GIGNRQAASLPDYSNYSDALKNSKWQWTPAQLKTYLSQSSSKALPGTKMKYEGLDDPKEL
DALIVYLNSLK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcatccattccacaagaccctgttgtgcgccccgctcgccggcctgctattggccggc
gccaccctggcaccgccggcgcgtgccgccgacggtgcgggcaaggacaccttcatggcc
gaatgcgccgaatgccacagcgcaacgcaaggcaagaacaagaaaggcccgtccatgttc
ggcattggcaaccgccaggcggccagcctgccggactacagcaactactccgacgcgctc
aagaacagcaagtggcagtggacgccggcacagctgaagacctacctgtcgcagtcttcg
tccaaggcgctgcccggcaccaagatgaagtacgaaggcctggatgatcccaaggagttg
gacgcactcatcgtctatctcaacagcctcaaatga

DBGET integrated database retrieval system