KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2786Help
Entry
xccb100_2786      CDS       T00759                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_2786 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    xccb100_2786 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    xccb100_2786 (sucB)
Enzymes [BR:xca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     xccb100_2786 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3200907..3202115
Genome map
AA seq 402 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPAEEKKADATAAAAAAAPAPAAAAAAAPVASKSSA
DSLPPGARFSAITQGVDPSQVDGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVAMTR
VRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKAAA
NALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERQSFAEVEQGIADYA
AKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQVV
IAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggtgaagcggtcaagcgcgacgagaatctggtcgatctggaa
accgacaaggtcgtgttggaagttccttcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcacggtcaccagcaaccagatcctggcgatcatcgaagaaggcgcc
gtggccgcagctgcaccggccgaagagaagaaggccgatgccacggcggccgccgctgct
gctgcgccggcaccggctgccgctgccgctgccgcgccggttgcatcgaagtcgtctgct
gacagcctgccgccgggtgcgcgtttttccgccatcacccagggcgtggatccgtcgcag
gtcgacggcaccggccgtcgtggcgcggtgaccaaggaagatatcgtcaacttcgccaag
gccggcggcgtgggcaaggcgtctggcgcccgtcctgaagagcgcgtggcgatgacccgc
gtgcgcaagacgatcgccaagcgcctgatggagtccaagaactccaccgcgatgctgacc
accttcaacgaggtcaacctcgccaaggtgtcggccgcgcgcaaggaactgcaggacgaa
ttccagaaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggccgcggcc
aacgcactgcagcgcttcccactggtcaacgcctcgatcgacggcgacgacatcatctat
cacggctacagcgacatctcgatcgccgtctccaccgagaagggcctggtgacgccggtg
ctgcgtaacgtcgagcgccagtcatttgccgaagtcgaacagggcatcgccgactacgcc
gccaaggcgcgcgccggcaagctgggcctggacgacctgcagggtggcaccttcaccatc
accaatggcggcaccttcggctcgctgttgtcgaccccgatcatcaacccgccgcagagc
gccatcctgggcatgcacgcgatcaaggaacgtccgatcgccgagaacggccaggtcgtg
atcgcgccgatgatgtacctggcgctgtcctacgaccaccgcatcatcgacggcaaggat
tcggtgcagttcctggtcgacatcaagaatcagctggaaaacccgggccggatgctgttt
ggcctctaa

DBGET integrated database retrieval system