KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2878Help
Entry
xccb100_2878      CDS       T00759                                 

Gene name
pldA
Definition
hypothetical protein
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    xccb100_2878 (pldA)
   00565 Ether lipid metabolism
    xccb100_2878 (pldA)
   00590 Arachidonic acid metabolism
    xccb100_2878 (pldA)
   00591 Linoleic acid metabolism
    xccb100_2878 (pldA)
   00592 alpha-Linolenic acid metabolism
    xccb100_2878 (pldA)
Enzymes [BR:xca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     xccb100_2878 (pldA)
    3.1.1.32  phospholipase A1
     xccb100_2878 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3292912..3294042
Genome map
AA seq 376 aa AA seqDB search
MSKHRTRPLMLIALAAAPLAHAQEIAPQLASPQACTSVTSDAARLACYDQALGYTPQAVQ
EADAAAQLAKQAAKSEDTRKISRVGDFFRADGQDQPKEEAVANAGRGSLLDRRWELAKDS
KLGTFQLRGYKPVYLLPAFWTSDTNRTPQSPNPANSVSTPQQLDSAELKFQLSFKTKVVE
DLFGDNGDIWMGYTQSSRWQAYNSDASRPFRETNYEPEAMLVFRNNYSIFGWKGRMSGIS
INHMSNGREDPLSRSWNRVILNIGLDRENWALTLRPWFRIKEDRADDNNPDIEDYMGRGD
ATLVYNKDGHEFALIARHSLRGGDRSHGSVQLDYGFPITNLLRGHVQVFDGYGESLIDYN
HKATYVGVGVSLLEWF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaccgtacccgtcccctaatgctgatcgccctggccgctgcgccgctggcg
cacgcgcaggaaatcgctccacagctagcatcgccgcaggcctgtacctccgtgacttcg
gatgccgcgcgtctggcgtgctacgaccaggcgctgggatataccccgcaggccgtgcag
gaggcagatgccgccgcgcagttggccaagcaggccgccaaatcggaagacacccgcaag
atcagccgcgtgggcgatttcttccgcgccgacggccaggaccagccgaaggaagaagcg
gtcgccaatgccggccgcggctcgctgctggaccgccgttgggagctggccaaggattcc
aagctggggaccttccagctacgcggctacaagccggtctatctgttgccggcattctgg
accagcgacaccaaccgcacgccgcaatcgccgaacccggccaactcggtcagcacgccg
cagcaactggacagcgccgaactgaagttccagctgagcttcaagaccaaggtggttgag
gatctgttcggcgacaacggcgatatctggatgggctatacccagagctcgcgctggcag
gcctataactccgatgcctcgcgcccgttccgcgagaccaattacgagccggaagcgatg
ctggtgtttcgcaacaactacagcatcttcggctggaaaggccgcatgagcggcatcagc
atcaatcacatgtccaacggccgcgaagacccgctgtcgcgttcctggaaccgggtgatc
ctcaacatcggcctggatcgcgaaaactgggcgctgaccttgcgcccgtggttccgtatc
aaggaagaccgtgccgacgacaataatccggatattgaggattacatgggccgcggcgac
gccaccctggtctataacaaggatggccacgaattcgccttgattgcccggcattcgctg
cgtggcggcgaccgctcgcacggctcggtgcaactggattacggcttcccgatcaccaac
ctgttgcgcggccacgtgcaggtgttcgatggctacggcgagagcctgatcgactacaac
cacaaggccacctatgtgggcgtgggcgtgtcgttgctggaatggttctga

DBGET integrated database retrieval system