KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2885Help
Entry
xccb100_2885      CDS       T00759                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    xccb100_2885
  Metabolism of other amino acids
   00480 Glutathione metabolism
    xccb100_2885
Enzymes [BR:xca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     xccb100_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3301124..3301609)
Genome map
AA seq 161 aa AA seqDB search
MTTLSTYQFTDLDGQPQSLAEYAGKVVLVVNVASKCGFTPQYTGLQALWQRYRDRGLVVI
GFPCDQFGHQEPGDAADIRQFCSLDYAVDFPLAAKVEVNGSGAHPLWQWLKHEKRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALGV
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctctccacctaccagttcaccgacctggacggtcaaccccagtcgctggcc
gagtacgccggcaaggtggtgctcgtggtcaacgtggcctccaaatgcggttttacgccg
cagtacaccggcctgcaggcgctgtggcagcgctaccgcgaccgcgggctggtggtgatc
gggtttccctgcgatcagttcggccatcaggagcctggagatgcggcggacatccgccag
ttctgctcgctggactacgcggtggattttccgctcgcggccaaggtcgaggtcaatggc
agcggtgcccacccgctgtggcaatggctcaagcacgaaaaacgcggcgtgctgggctcg
gaagcgatcaagtggaatttcaccaaattcctgatcggccgcgacggccgcgtgctggag
cgctatgcgccgaccaccaaaccggaggcgctggcggcggatatcgaacgcgcgctgggc
gtttga

DBGET integrated database retrieval system