KEGG   Xanthomonas campestris pv. campestris B100: xccb100_2965Help
Entry
xccb100_2965      CDS       T00759                                 

Definition
delta 9 acyl-lipid fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:xca01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xca01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3396971..3397972
Genome map
AA seq 333 aa AA seqDB search
MPSSGLDPRVAPTPHPATPPQRAGKARRFGSLRRWVDSQTDEPLDEARADRIDWLRALPF
IALHLACFAVFWVGVSWFAVSMAVALYALRMFALTGFYHRYFSHRAFKTSRVVQFVFAAI
AATCVQRGPLWWAAHHRNHHRHTDTGRDPHSPAQHGFWWSHTGWFLTPRNFRTDWEVIPD
LRRFTELRFLDRFDIVMPVLLALGLYLLGDWLAAAAPGLHTSGAQLLVWGFVLSTVALFH
ATFTINSLAHRFGSRRFDTRDDSRNNWLLALLTFGEGWHNNHHFFPGSARQGVRWWEYDM
TWYGLTVMSWVGLVWDLKPMPAMLTRRAGRVAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgccgagctctggactcgacccccgcgtcgcacccacgccccaccccgccaccccgcca
cagcgcgcgggcaaggcccggcggttcggcagcctgcgtcgctgggtggattcgcaaacc
gacgaaccgctggacgaagcccgcgcggaccgcatcgactggctgcgtgcgctgccgttc
atcgccttgcacctggcctgctttgcggtgttctgggtcggtgtgtcgtggttcgcagtg
agcatggccgtggcgctgtacgcgctgcgcatgttcgcgctgaccgggttctatcaccgc
tatttctcgcaccgcgcattcaagacctcgcgcgtggtgcagttcgtgttcgccgcgatc
gccgccacctgcgtgcaacgtgggccgctgtggtgggccgcacaccatcgcaaccatcac
cggcataccgacaccggccgtgacccgcattcgccggcacagcacggcttctggtggagc
cataccggctggttcctgaccccgcgcaatttccgcaccgattgggaagtgattccggat
ctgcgccgcttcaccgagctgcgatttctggaccgcttcgacatcgtgatgccggtgctg
ctggcactgggcctgtacctgctgggcgactggctggcggctgcagcgcctggcctgcac
accagtggcgcgcagttgctggtgtggggcttcgtgctgtccacggtggcgttgttccat
gccaccttcaccatcaattcgctggcgcaccgcttcggcagccggcgcttcgacacccgc
gacgacagccgcaacaactggttgctggcgctgctcaccttcggcgagggctggcacaac
aaccatcatttctttcccggctcggcgcgccagggcgtgcgttggtgggaatacgacatg
acctggtacgggctcacggtgatgtcgtgggtgggcctggtgtgggatctcaaaccgatg
cccgccatgctgacgcgacgcgccggacgggtggcgcgatga

DBGET integrated database retrieval system