KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3037Help
Entry
xccb100_3037      CDS       T00759                                 

Gene name
fadB3
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    xccb100_3037 (fadB3)
   01212 Fatty acid metabolism
    xccb100_3037 (fadB3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    xccb100_3037 (fadB3)
   00650 Butanoate metabolism
    xccb100_3037 (fadB3)
  Lipid metabolism
   00071 Fatty acid degradation
    xccb100_3037 (fadB3)
   01040 Biosynthesis of unsaturated fatty acids
    xccb100_3037 (fadB3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    xccb100_3037 (fadB3)
   00310 Lysine degradation
    xccb100_3037 (fadB3)
   00380 Tryptophan metabolism
    xccb100_3037 (fadB3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    xccb100_3037 (fadB3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    xccb100_3037 (fadB3)
   00281 Geraniol degradation
    xccb100_3037 (fadB3)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    xccb100_3037 (fadB3)
Enzymes [BR:xca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     xccb100_3037 (fadB3)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     xccb100_3037 (fadB3)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     xccb100_3037 (fadB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3466694..3468766
Genome map
AA seq 690 aa AA seqDB search
MLPGFDGLRFSHWQADLREDGVLVLSLDRQGAAVNAFSQDVLLELGDVIERLALDPPKGV
VLRSAKANGFIAGADLKEFQEFDRRGTVNDAIRRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLTGRTVS
AKAARAMGLVDKVAAPAVLVDVAAALALAGTTRPFKQRATAWATNTLLARKLLAPQMRKQ
VARKARKEHYPAPYALITTWERAGGGGIQARLAAERKAVVKLASTPAARNLIRIFFLTER
LKALGGKDTGLPAIRHVHVVGAGVMGGDIAAWAAYKGFEVTLQDREQRFIDTALARGGEL
FGKRVKDETKRPAVAARLRGDLAGSGVAQADLIIEAIIENPQAKRDLYQSIEPHLKPDAL
LTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLAAFCKA
LDKFPVPVAGTPGFLVNRVLFPYLLEASTAYAEGIPGPVLDKTAVKFGMPMGPIELIDTV
GLDVAAGVGAELAPFLGLPIPAALATVEAGKRGKKDGQGLYKWENGRAVKPEVASGYEVP
TDLEDRLILPLLNEAVACLHEGVVADADLLDAGVIFGTGFAPFRGGPIQHIRSVGADALL
ARLHALQARYGERFVPRPGWESPVLREPVA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggcagacctgcgcgaggac
ggcgtgctcgtgctcagcctcgaccgccagggcgcagcggtcaatgccttctcgcaggac
gtgctgctcgaactgggcgatgtcatcgaacgcctggcactggatccgcccaagggcgtg
gtgctgcgctcggccaaggccaatggcttcatcgccggcgccgacctgaaggaattccag
gaattcgaccgccgcggcaccgtcaacgacgcaattcggcgcggccagcaggtgttccag
aaactggccgagctgccctgccccacggtggccgccatccacggcttctgcatgggcggc
ggcaccgagattgcactggcctgccgctaccgggtggcctccgacgatggcagcacgcgc
atcgggctgccggaaaccaagctcggcatctttcccggctggggcggcagcgcccgcttg
ccgcgcctgatcggggcaccggcggcaatggacttgatgctcaccgggcgcacggtgtcg
gccaaggctgcgcgggcgatgggcctggtcgacaaggttgccgcaccggcggtgctggtg
gatgtggctgcggcgctggcattggccggcaccacgcgcccgttcaagcaacgcgccacc
gcctgggcgaccaacactctgctcgcacgcaagctgctggcaccgcagatgcgcaagcag
gtcgcgcgcaaggcccgcaaggaacactatcccgcgccgtatgcgttgatcaccacgtgg
gagcgcgccggtggcggcgggatccaggcccgcctggcggccgagcgcaaggcagtggtc
aagcttgccagtacgccggcagcgcgcaatctgatccgcatcttcttcctgaccgagcgg
ctcaaggcccttggcggcaaggacaccggcttgcccgccatccgccacgtgcatgtcgtc
ggtgccggcgtgatgggcggtgatatcgcggcgtgggccgcctacaagggctttgaagtc
acgctgcaggaccgcgaacagcgcttcatcgataccgcccttgcgcgcggcggcgaacta
tttggcaagcgcgtaaaggacgagaccaagcgccccgccgtggccgcacgtctgcgcggc
gatctggccggcagcggcgtggcgcaggcggatctgatcattgaagcgatcatcgaaaac
ccgcaagccaagcgcgacctgtatcagagcatcgagccgcacctcaagccggatgcgcta
ctcaccaccaacacctcctcgatcccgttgaccgaattgcgtgggcacatccagcgcccg
gcacagtttgccggcctgcactatttcaacccggtggcgatgatgccgctggtggaaatc
gtgcagcacgacgggctggatccggccaacgtggcgcggctggccgcgttctgcaaggcg
ctggacaaattcccggtgccggtcgccggcacgccggggttcctggtcaaccgcgtgctg
ttcccgtacttgctggaagcgtccaccgcgtatgccgagggcattcccgggccggtgctg
gacaagaccgcggtgaagttcggcatgccgatggggccgatcgaattgatcgacaccgtg
ggcctggacgtggccgccggcgtcggtgcggagctcgccccgttcctgggcctgccgatc
ccggcagcactggccacggtggaggccggcaagcgcggcaagaaggacggccagggcttg
tacaaatgggaaaacggccgcgcggtcaaacccgaagttgccagcggctacgaggtgccg
acagacctggaagaccgcctgatcctgccattgctcaacgaagcggtggcctgcctgcac
gaaggcgtggtggccgatgcggacctgctcgatgccggcgtgatcttcggcaccggcttt
gcgcccttccgcggcggcccgatccagcacatccgcagcgtcggtgcagacgcgctgctg
gcccgcctgcatgccttgcaggcgcggtatggcgagcggtttgtaccgcggccgggttgg
gagtcgccagtgttgcgggagccggtggcataa

DBGET integrated database retrieval system