KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3047Help
Entry
xccb100_3047      CDS       T00759                                 

Gene name
bga3
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    xccb100_3047 (bga3)
  Lipid metabolism
   00600 Sphingolipid metabolism
    xccb100_3047 (bga3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    xccb100_3047 (bga3)
Enzymes [BR:xca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     xccb100_3047 (bga3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3481962..3484529
Genome map
AA seq 855 aa AA seqDB search
MTGINRRELLRGMLASGVRAALPAGAAGALLPGSADAAPAAAKDATPLAPLGDASLAPRE
RLLFDFGWRFHPGHASDPSRDFEFGTFQRTFAKAGKDTATAAQLAFDDSNWQQVDLPHDW
AVTLPFRPEPISASMTEEDPAAAHGYKALGTSFPENSVGWYRRMLQIPASDLGKRICLVF
DGVFRDCVVFCNGHIVGRNASGYCGFEVDLSEVLDYGKPNLIVVRVDATLGEGWFYEGAG
IYRHLWLQKTDPLHVPQHGVFVRSSVQGDTATAQLSTEVRNDGTASRQCVVQARITAPYG
RIVAQAASAAVTVAPGQVQVVEQTVPLGQAALWSIDTPQLYTLTTSVHSAGVAVDALVTP
FGVRSIAFDAQRGFLLNGAPLKLHGTNNHQDHAGVGTAIPDALHAWRLRQLKSMGCNAYR
SSHNPATPELLALCDRLGMFVIEETRRMSTDPEAMAELETMVRRGRNHPSVILWSLGNEE
PQQVTERGARIVTRMQQRVRQLDPTRPTTFAMDKGFGDGVGQVVDVVGFNYRTSQMDGFH
AQYPNIPIYGSETGSTVSVRGNYQRDDTRGYTRAYDTDHPWWASTAEAWWSYVAQRPYIA
GGFIWTGFDYRGEPTPYNRWPNVGSQFGVLDSCGFPKDNYWYYRAQWTSEPVLHLFPHWN
WDGLLQPDDKGRVEVWCHSNLEAVELLVNGVSQGLQQVPAYGHVEWRVAYAPGVIEARGY
RGGKLVLTERRETVGKPAAIRLSCDRSALRADAEDVAVVKVEIVDAQGRLVPNADHLVHL
VLRGPARLIGVGNGDPSSHEDDKAPQRKAFNGLCMALLRSTRSSGQILLQATAPGLTSAA
LHLQAATSALRPSVD
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcaatcgccgcgaattactgcgcggcatgttggcaagtggcgtgcgtgcc
gcactcccggccggtgcagccggtgcgctgttgcccggcagtgcggatgcagcgccagcc
gcggcgaaagatgccacgccgctcgccccgctcggcgatgcaagcctggcaccacgcgaa
cggctgctgttcgacttcggttggcggttccatcccggccatgccagcgacccatcgcgc
gacttcgagttcggcaccttccagcgcaccttcgccaaggccggcaaggacaccgccacc
gccgcgcaactggccttcgacgacagcaactggcaacaggtggacctgccgcacgactgg
gccgtgaccctgcccttccgtccggagccgatctccgcctcgatgaccgaagaagacccg
gcggccgcgcacggctacaaggcgctgggcacgagctttccggaaaacagcgtgggctgg
tatcggcgcatgctgcagatcccggccagcgatctgggcaagcgcatctgcctggtgttc
gacggcgtgttccgcgattgcgtggtgttttgcaacggccacatcgtcgggcgcaacgcc
agcggctattgcggcttcgaggtcgacctgagcgaagtgctcgactacggcaagcccaac
ctcatcgtcgtgcgcgtggatgccacgctcggcgaaggctggttctatgaaggcgccggc
atctaccggcatctgtggctgcagaagaccgacccgctgcacgtgccgcagcatggcgtg
tttgtgcgcagcagcgtgcaaggcgacaccgccaccgcgcagctttccaccgaagtgcgc
aacgacggcaccgcgtcacgccagtgcgtggtgcaggcccgcatcaccgcaccgtatgga
cgcatcgtggcgcaagcggccagcgcagcggtcacggttgcgcccggtcaggtacaggtc
gtcgaacagaccgtgccgctcggccaggccgcgttgtggtcgatcgacaccccgcagctc
tacaccctcaccaccagcgtgcacagcgcaggggttgcggtcgatgcgcttgtcacaccg
ttcggcgtgcgcagcatcgctttcgatgcgcaacgcggctttctattgaatggtgccccg
ttgaaattgcacggcaccaataatcaccaggaccatgccggcgttggcacggccattccc
gatgccttgcacgcatggcgcctgcgccagctcaagtcgatgggctgcaacgcgtatcgc
agctcgcacaatccggccacccccgaactgctcgcgctgtgcgaccgcctgggcatgttc
gtgatcgaagaaacccggcgcatgtccaccgacccggaggcaatggccgaactggagaca
atggtccggcgcgggcgcaaccaccccagcgtgatcctgtggtcgctcggcaacgaagag
ccgcaacaggtcaccgaacgcggcgcgcgcatcgtcacgcgcatgcagcaacgcgtgcgc
cagctcgaccccacccgccctactacgttcgccatggacaagggctttggcgacggcgtg
ggccaggtggtggatgtggtcggcttcaactaccgcaccagccagatggacggcttccac
gcgcaatatcccaatattccgatctacggcagcgaaaccggcagcaccgtctcggtgcgc
ggcaactaccagcgcgacgatacccgcggctacacccgcgcctacgacaccgaccacccg
tggtgggccagcactgccgaagcctggtggagctacgtcgcgcaacgcccgtacatcgcc
ggcggctttatctggaccggtttcgattaccgcggcgaacccacaccctacaaccgctgg
ccgaatgtcggctcgcaattcggcgtattggatagttgcggctttcccaaggacaactac
tggtactaccgcgcgcagtggaccagcgagccagtgctgcatctgttcccgcactggaac
tgggacggtctgctgcagcccgatgacaaaggccgcgtcgaggtctggtgtcacagcaat
ctcgaagcggtggaactactggtcaacggcgtcagccagggcctgcagcaggtgcctgcc
tacggccatgtcgaatggcgcgtggcatacgcaccgggcgtgatcgaagcgcgcggctat
cgcggcggcaaactggtgctcaccgaacgccgtgaaaccgtcggcaagccggcagcgatc
cgcctgagttgcgatcgcagcgcactgcgcgccgatgccgaagatgtggcggtggtgaaa
gtggagatcgtcgatgcgcaaggccggcttgtaccgaatgccgaccacctggtgcacctc
gtcctgcgtggacctgcacgtctgatcggcgtgggcaacggcgaccccagcagccacgaa
gacgacaaggcgccgcagcgcaaggcatttaacggcttgtgtatggcgttgctgcgaagc
acgcgcagcagcggccagatcctgctgcaggccaccgcgccaggcctgacctcggcagcg
ctgcatctgcaggctgccacgtcggccttgcggccgtcggtcgactga

DBGET integrated database retrieval system