KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3156Help
Entry
xccb100_3156      CDS       T00759                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xca00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    xccb100_3156
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    xccb100_3156
Enzymes [BR:xca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     xccb100_3156
Two-component system [BR:xca02022]
 CheA family
  CheA-CheYBV
   xccb100_3156
Bacterial motility proteins [BR:xca02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    xccb100_3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3599034..3599621
Genome map
AA seq 195 aa AA seqDB search
MSPATPQYLEFDAIVIGASAGGVMALQTLLSGLPATLPMPVLVVLHLPRDRPSQVAELLD
ARCALPVREAIDKQPLQPGTVTIAPPDYHLLVEGRDSLALSMDAPVLFSRPAIDPLFESA
ADVFGQRLLAILLTGASSDGSAGVAAVRTAGGSAWIQRPDDAASPLMPASALAHAGADAV
LTLQAICSRLEAFHA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggccacgccgcagtatctggaattcgatgccatcgtgatcggcgcttccgcc
ggtggcgtgatggcattgcagacgctgttgtccggcctgccggccacgctgccgatgccg
gtgctggtggtgctgcatttgccgcgcgaccgccccagccaggtggccgagctgctggat
gcgcgctgcgcgctgccggtgcgcgaagccatcgacaaacaaccgctgcagcccggcacg
gtgaccatcgcgccgccggactatcacctgctggtggaaggccgcgacagcctggcattg
tcgatggatgcaccggtgctgttctcgcgcccggcgatcgacccgttgttcgaatcggct
gccgatgtgttcggccagcggctgctcgcgatcctgctcaccggtgccagcagcgacggc
agtgccggcgtggccgcggtgcgcactgccggcggaagcgcgtggatccagcgccccgac
gatgccgcatctcccctgatgcccgcctccgcgctcgcccatgccggcgccgatgcggtg
ctcaccctgcaggcgatctgcagccgactggaagcctttcacgcatga

DBGET integrated database retrieval system