KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3269Help
Entry
xccb100_3269      CDS       T00759                                 

Definition
O-Glycosyl hydrolase family 30 protein precursor
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    xccb100_3269
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    xccb100_3269
Enzymes [BR:xca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     xccb100_3269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3735919..3737619)
Genome map
AA seq 566 aa AA seqDB search
MVEGCMVALVCGAMLRRVGRLGLVTNLGGCTVKRAIAWSMVGVLGVWGAATETVLASASA
SASATATAATATATATATPIPVPVSTASASTPASKAVEAAVADAAVPPAAPAGALRVYTS
AQGATQQMRVSTVDVPTAGHALTEKENSIFVNPQRRFQALLGIGGAITDSSAETFAKLPK
QAQRQLLTAYYDPDKGIGYTLARTTIHSSDFSSGSYTYIKEGDAALKTFSVQHDAKYRIP
MLRQAIAAAGGTLTTFASPWSAPAFMKDSNAMLKGGKLLPEYAQAWATYYTRFIAAYEKA
GIPIWGISLQNEPMAVQTWESMLFSAEEERDFLKNHLGPTMAKAGYGDRKIIVWDHNRDM
MVHRAHVIFDDPEASKYAWGMGFHWYETWAGFAPMVENVAAVAQAYPDKHLLLTEAAVEK
FDPAKLQHWPNGERYGTAIINDLNHGAVGWTDWNILLDEHGGPNHVGNYCFAPVHANTRT
GEVIYTPSYWYIGHFSKFIRPGAQRVSAASSRSNLATTAFVNSDGSLATVVMNATDVAIR
YNLYVGDASSVLEIPAHAIQTVVLAQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaggatgcatggttgcgctcgtttgtggcgcgatgttgcgccgcgttggtcgg
ttaggcttggtcaccaacctgggagggtgcacggtgaagcgagcgattgcgtggtcgatg
gtgggggttctgggagtttggggtgctgcgactgaaacggtgttggcatctgcttctgct
tctgcatctgcaacagcaacagcagcaacagcaacagcaacagcaacagcaacgcctatt
ccggtgccggtatcgacggcatctgcatccacgcccgcatcgaaggcggtagaggctgcg
gttgcggatgctgctgttccgccagcagcacctgccggcgcactacgcgtttacacctct
gcccaaggcgcaacgcagcagatgcgtgtcagcactgtcgatgtgcccacggcagggcat
gcgttgaccgagaaagagaattccatcttcgtcaatccacagcggcggtttcaggcgttg
ctgggcattggcggggcgatcaccgattccagcgcggaaaccttcgccaaactgcccaag
caggcgcagcggcaactgctcaccgcctactacgacccggacaagggcatcggctacacg
ctggcgcggaccaccatccatagctcggatttcagcagtggcagctacacctatatcaag
gaaggcgacgcggcgctgaagaccttttcggtgcagcacgatgcgaaataccgcattccg
atgctgcgccaggccattgctgcggccggtggcacgctcaccacgtttgccagcccgtgg
agcgcgccggccttcatgaaagacagcaacgccatgctcaagggcggcaagctgttgccc
gaatatgcgcaggcctgggccacgtactacacgcgcttcattgccgcgtatgaaaaggcc
ggcatcccgatctggggcatcagcctgcagaacgagccgatggcagtgcagacctgggag
tcgatgctgttttctgcggaagaagagcgcgactttctcaagaatcatctgggccccacc
atggccaaggccggctatggcgatcgcaagatcatcgtgtgggaccataaccgcgacatg
atggtgcaccgcgcgcatgtgatcttcgatgatccggaggcttccaaatatgcgtggggc
atgggcttccactggtacgaaacctgggccgggttcgcgccgatggtggagaacgtggcg
gcggtggcacaggcgtacccggacaagcacctgctgctcaccgaagcggcggtggaaaag
ttcgacccggccaagctgcagcactggcccaatggcgagcgctatggcacggccatcatc
aacgacctcaatcacggtgcggtgggttggacggactggaacatcctgctggacgagcac
ggtggccccaatcacgtgggcaactattgctttgcaccggtgcatgccaacacgcgcacc
ggcgaggtgatctacacgccgagctattggtatatcggccacttttccaagttcatccgg
cctggcgcgcagcgggtgagtgcggcgagcagccgcagtaacctggctaccactgcgttc
gtcaacagcgatggcagcctggcgacggtggtgatgaatgccacggatgtggcgatccgc
tacaacctgtatgtgggcgatgcctccagcgtgctggagattcccgcgcatgcgatccag
acggtggtgctggcgcagtga

DBGET integrated database retrieval system