KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3357Help
Entry
xccb100_3357      CDS       T00759                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xca03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3827806..3828399)
Genome map
AA seq 197 aa AA seqDB search
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALANAVEKVGHCVQCRD
FTESEVCAICANSGRDRQQLCVVESPADRLAIEHATGYRGVYFILQGRLSPLDGIGPREL
GLDRLAERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHSVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccttctagaacaactgatcgaagccttccgggtgctgcccggtgtgggtcag
aagtcggcgcagcgcatggcgtaccacgtgctcgagcgtgagcgcgagggtgggcggcgg
ctggcggcggcgttggccaatgcggtggagaaggtgggccattgcgtgcaatgccgcgac
ttcaccgagtcggaggtgtgcgcgatctgcgccaattccggccgtgatcggcagcagctg
tgcgtggtggaatcgcccgccgatcgcctggcgatcgagcacgccaccggctaccgcggg
gtgtatttcatcctgcaggggcgtttgtcgccgctggatggtatcggcccgcgtgagttg
gggctggaccgcctggccgagcgtctggcagcgggcgaggtcaccgaaatgatcatcgcc
accaacgccaccgtcgagggcgaggccaccgcgcattacctggcgcaactggcccgccaa
cacagcgtgcgccccagccggctcgcacaaggcatgccgctgggcggcgagttggagtac
gtggatcgcggcacgctgtcgcatgcgttcggcacgcgtagtgaggtgctttag

DBGET integrated database retrieval system