KEGG   Xanthomonas campestris pv. campestris B100: xccb100_3574Help
Entry
xccb100_3574      CDS       T00759                                 

Gene name
tesA
Definition
acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xca00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    xccb100_3574 (tesA)
Enzymes [BR:xca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     xccb100_3574 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     xccb100_3574 (tesA)
Lipid biosynthesis proteins [BR:xca01004]
 Fatty acid synthase
  Component type
   xccb100_3574 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4043342..4044010)
Genome map
AA seq 222 aa AA seqDB search
MRNLRMRERTLRYSVMSLWLLTLSLLAPGIASAKSPATAAPILVVGDSLSAAHNIPVQSG
WVTLLDQRLKRDMATPPPVVNASISGETTSGALTRLPGLLQKHRPGVVVIELGGNDALRG
LTPAQLKGNLEKMIQLSRQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYQTALVP
FFLEKVALQPGLMQADGLHPTAAAQPKVLETVWPALQPLLKP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatctccgaatgcgtgaaagaacactgcggtacagcgtgatgagcctgtggctg
ctgacactctccctgcttgcgccggggattgcctctgccaaaagtccggccactgccgcg
ccgatcctggtggtgggtgatagcctgagcgccgcgcacaacatcccggtgcagtccggc
tgggtcaccctgctggaccagcgcctgaagcgtgacatggcgacgccaccgccggtcgtc
aatgccagcatcagcggcgaaaccacctccggcgccttgacccggctgcctgggctcctg
caaaagcaccgccccggcgtggtcgtcatcgagctgggtggcaacgatgccttgcgcggc
ctcacgccggcccagctcaaaggcaacctggagaagatgatccagctcagccgtcaggcg
ggtgcgaaggtcttgctgctgggcatcgatgtgccgcccaactatggcccggcctatcgc
gagcggctgaaggcgacctatgccgacctgtccaagcaataccagaccgcgctggtgccg
ttctttctcgagaaggtcgccctgcagccgggcctgatgcaggccgacggtctgcatccc
accgccgccgcacagcccaaggtgctggaaacggtctggccagcactgcagccgctgctc
aaaccctga

DBGET integrated database retrieval system